KEGG   Yersinia pestis 91001 (biovar Microtus): YP_0266Help
Entry
YP_0266           CDS       T00165                                 

Gene name
aceF
Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm00010  Glycolysis / Gluconeogenesis
ypm00020  Citrate cycle (TCA cycle)
ypm00620  Pyruvate metabolism
ypm01100  Metabolic pathways
ypm01110  Biosynthesis of secondary metabolites
ypm01120  Microbial metabolism in diverse environments
ypm01130  Biosynthesis of antibiotics
ypm01200  Carbon metabolism
Module
ypm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ypm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YP_0266 (aceF)
   00020 Citrate cycle (TCA cycle)
    YP_0266 (aceF)
   00620 Pyruvate metabolism
    YP_0266 (aceF)
Enzymes [BR:ypm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     YP_0266 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA Ifi-6-16
Motif
Other DBs
NCBI-ProteinID: AAS60542
UniProt: A0A0H2W0C1
Position
270935..272464
Genome map
AA seq 509 aa AA seqDB search
MSIEINVPDIGADEVEVTEIMVKVGDTVEAEQSLITVEGDKASMEVPSPQAGVVKEIKIA
VGDKVATGSLIMVFDATGAAAAPVKAEEKPAAPAQVAAPAASAAKNVEVPDIGDDEVEVT
EVMVKVGDKVDAEQSLITVEGDKASMEVPAPFAGIVKEIKISTGDKVKTGSLIMVFEVEG
AAPAPAAAPAAKAESKGEFAENDAYVHATPVIRRLAREFGVNLAKVKGTGRKGRILREDI
QAYVKDAVKRAEAAPAAAGGGLPGILPWPKVDFSKFGEIEEVELGRIQKISGANLSRNWV
MIPHVTQFDEADITEVEAFRKQQNIEAEKKKQDLKITPLVFLMKAAAKALEEFPRFNSSI
SEDGQKLTLKKYINIGVAVDTPNGLVVPVFRDVNKKGIVELSRELSVISKKARDGKLTAS
DMQGGCFTISSLGGIGGTAFTPIVNAPEVAILGVSKSSMKPVWNGKEFAPRLMLPLSLSF
DHRVIDGAAGARFAAYIATIMADIRRLVM
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtctatagaaattaatgtaccagacatcggtgcagatgaagtggaagtcaccgaaatt
atggtgaaagtgggcgataccgttgaagcggaacagtcgctaatcaccgttgaaggcgat
aaagcttccatggaagttccttcacctcaggcgggcgtggttaaagagatcaaaattgcg
gttggcgataaagtggctaccggttctctgatcatggtcttcgacgctacgggtgccgct
gcggcaccggttaaagcagaagaaaaaccggcggcgcctgctcaggtagcggctccggca
gcctctgcggcgaaaaatgttgaagtgccagatatcggtgatgacgaagttgaagtgact
gaagtgatggtgaaagtgggcgataaagttgacgccgaacaatcactgattacggttgaa
ggcgacaaagcgtcgatggaagtgcccgcaccgtttgctggtatcgtgaaagaaatcaaa
atcagtaccggcgacaaagtgaaaaccggctctctgattatggtcttcgaagttgaaggt
gcagcgccagcgccagccgccgcacctgccgccaaagcagaaagcaaaggcgagtttgcc
gagaatgacgcttacgtgcatgccacgccggttatccgtcgtctggcgcgtgagttcggt
gtgaacctggcgaaggtgaaagggacaggccgtaagggccgtatcctgcgcgaagacatt
caagcttacgtgaaagatgccgtgaaacgtgccgaagctgcaccagcagcggctggcggc
ggcctgccgggcatattgccttggccaaaagttgatttcagtaaatttggtgaaatcgaa
gaagtcgaattgggccgtatccagaaaatttctggtgcgaacctgagccgtaactgggtc
atgatcccacatgtgacgcaattcgatgaagcggatatcactgaagttgaagccttccgt
aagcaacagaacatcgaagctgagaagaaaaaacaagacctgaaaatcaccccgctggtg
ttcctgatgaaggccgccgctaaagcactggaagaattcccacgctttaacagctccatt
tccgaagatggtcagaaactgacgctgaagaaatacatcaatatcggtgtggcggttgat
acgcctaacggcttggtagttccagtattccgtgacgtcaacaaaaagggtattgtcgag
ttgtctcgtgagctatctgtcatctccaagaaagcacgtgatggcaagctgacagcatct
gacatgcaaggcggctgtttcactatctccagtctgggcggtatcggcggtacggcattt
acgccaatcgtcaatgcgccagaagtggctatcttgggtgtatcaaaatcatccatgaaa
cctgtctggaatggtaaagagtttgctccacgcctgatgttaccgctgtctctgtccttc
gatcaccgtgtgattgatggtgccgcgggtgcacgcttcgccgcgtatatcgctaccatt
atggcggatattcgccgtctggtgatgtaa

DBGET integrated database retrieval system