KEGG   Yersinia pestis 91001 (biovar Microtus): YP_0285Help
Entry
YP_0285           CDS       T00165                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ypm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(292291..292770)
Genome map
AA seq 159 aa AA seqDB search
MIRVYIALGSNLAMPLQQVSAAREALAHLPRSRLVACSPLYRTKPLGPQDQPDFLNAVVA
LDTSLPPEQLLDHTQAIERNQGRVRKEQRWGPRTLDLDIMLYGDQVIKTDRLTIPHYGLK
AREFMLYPLADIAPDLIFPDGESLSECLKRVDKNGLVLW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatccgggtctatatcgcgctgggtagcaatttggccatgccactacaacaggttagc
gcggcacgggaagccttggcgcatctgccgcgtagccggttagtagcgtgttcgccactt
taccgcaccaagccattaggcccacaggatcaacccgattttctcaatgccgtggtcgca
ctggatacatcgttgccaccagagcagttgctggatcacacacaagcgattgaacgtaac
caaggccgggtgagaaaagagcagcgctgggggccacggacgctggatctggatattatg
ttgtatggcgatcaggtgataaaaactgatcgcctgacgattccgcattatggtctgaaa
gcgcgtgaatttatgctctatccactggcagatatcgccccagatcttattttccccgat
ggcgaatccctatcagaatgccttaagcgggtcgataagaacggcttggttctctggtaa

DBGET integrated database retrieval system