KEGG   Yersinia pestis 91001 (biovar Microtus): YP_0334Help
Entry
YP_0334           CDS       T00165                                 

Gene name
rpiB1
Definition
(GenBank) ribose 5-phosphate isomerase B
  KO
K01808  ribose 5-phosphate isomerase B [EC:5.3.1.6]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm00030  Pentose phosphate pathway
ypm00051  Fructose and mannose metabolism
ypm01100  Metabolic pathways
ypm01110  Biosynthesis of secondary metabolites
ypm01120  Microbial metabolism in diverse environments
ypm01130  Biosynthesis of antibiotics
ypm01200  Carbon metabolism
ypm01230  Biosynthesis of amino acids
Module
ypm_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
ypm_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:ypm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    YP_0334 (rpiB1)
   00051 Fructose and mannose metabolism
    YP_0334 (rpiB1)
Enzymes [BR:ypm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     YP_0334 (rpiB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LacAB_rpiB
Motif
Other DBs
NCBI-ProteinID: AAS60607
UniProt: A0A0H2W2Q2
Position
complement(350662..351117)
Genome map
AA seq 151 aa AA seqDB search
MLSIAIGCDDAAIEMKNQIVIFLQSKNITVVDYSCDQHQEPTMYPDIAIQVALAIKAGKH
ERGILICGTGIGMSISANKVFGVRAAQCHDTFSAQRARKSNNAQIICLGARVIGPELAKT
LIEAWLDAEFDGGGSTEKVERIRYYEQSLHD
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgttatctattgcaatcggctgtgatgatgccgctattgagatgaaaaaccagattgtt
atttttctacaaagtaagaacatcactgtcgtcgattacagctgcgatcaacaccaagaa
ccgacgatgtaccccgatattgccattcaggttgctctggcgattaaagccgggaaacat
gaacgcgggatccttatttgtggaacaggtattgggatgagcatctctgccaataaagtt
tttggcgtccgtgcagctcagtgccatgatactttttctgcccaacgagccagaaaaagc
aacaatgcccaaattatctgtttaggcgctcgcgttattggcccggagttagccaaaacc
ctgatcgaggcttggttagatgctgaatttgacggagggggatcaacggaaaaagtggaa
cggatccgctattacgaacagagcctgcatgattga

DBGET integrated database retrieval system