KEGG   Yersinia pestis 91001 (biovar Microtus): YP_0345Help
Entry
YP_0345           CDS       T00165                                 

Gene name
mauG
Definition
cytochrome C peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(360863..362242)
Genome map
AA seq 459 aa AA seqDB search
MIRRGLIGGGILVIAGYLGIAGYLYMTDNTRNNTFISEAKTPNQQVSNILYQKGCDYCHT
ANASLPFYAAIPGPKQLMDYDIRQGNQHFSLEPTLLALKENRAVPEADLAKIESAIARDQ
MPPQRFNALHWSSSINAEERNQILDWVKIQRTTYFPSNSHSEMQHLALQPIPDALLVDNQ
KVALGSRLFHDPRLSGDNSISCASCHLLNKGGVDNLATSTGVDGQKGGINAPTVFNAVFN
VEQFWDGRAVDLQQQAGGPPLNPVEMASTSWEDIIAKLQQDPQLTQDFAQVYPQGYSEDT
ITDAIAEFEKTLTTPNSPFDHYLKGETQALTTSQQKGLALFQQNKCDTCHVGKNIGGQSY
EFLGLKSDYFADRQKEQTTDDLGRFNVTNDPRDMHRFKTPSLRNIALTAPYFHDAQAKDL
HQAVELMLKYQVGTQLPEQDINDIVAFLESLTGEYIPHS
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
gtgataagaagaggattaattggtggcggtatattggtaattgcaggttatctgggtatt
gctggctatctttatatgacagataacacacgtaataacaccttcatcagcgaggcaaaa
acacccaatcagcaggtcagtaatattctttaccaaaaagggtgtgattattgccatacc
gcgaatgcatccctgccattttatgccgctatccccggccctaaacaactgatggactat
gacattcgacaaggtaaccagcatttctcattggagccaacactattagcattaaaagaa
aatcgtgccgttcctgaagcagatttagccaaaatagaatcggctattgctcgcgatcaa
atgccacctcaacgctttaacgcattacattggtcctccagcatcaacgctgaggagcga
aaccagatccttgattgggtcaaaatacaacggacgacatacttcccttccaatagccac
agcgaaatgcagcacttagcactacagccgatccccgatgccttgctggtcgacaaccaa
aaagtggcactaggttcccgcctgttccatgaccccagattatccggtgataactctatt
tcctgtgccagttgccatctgttgaacaaaggaggcgttgataatctggcgacctcaacg
ggtgtcgatggacaaaaaggtgggatcaacgcgcctacggtatttaatgccgtatttaac
gtggagcagttttgggatggccgtgccgttgatttgcagcaacaagccggtggaccacca
cttaacccagtagaaatggcctcgacctcttgggaagatataattgctaaattgcaacaa
gacccacagttgacccaggactttgcccaagtgtatccgcaaggctattctgaagacacg
atcaccgatgcaatcgctgaatttgagaaaaccctgaccacccccaacagccctttcgac
cactatctgaaaggtgaaacacaggcattaacgactagccagcaaaaaggcttggcgcta
ttccagcaaaataaatgtgatacctgccacgtcggtaaaaatattggtgggcagtcctat
gagttcttggggctaaaaagtgactatttcgctgatcgccaaaaagagcaaactaccgat
gacctcgggcgtttcaacgtcaccaacgatccacgcgatatgcaccgctttaaaacaccg
agcttgcgtaatattgccttaacagccccttattttcacgatgcacaagctaaagattta
catcaggcggttgagctaatgctcaaatatcaggtagggacccaactaccagaacaggat
atcaacgatatagtggccttcctggaaagtttgaccggggaatatattcctcattcctga

DBGET integrated database retrieval system