KEGG   Yersinia pestis 91001 (biovar Microtus): YP_1041Help
Entry
YP_1041           CDS       T00165                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm00020  Citrate cycle (TCA cycle)
ypm00640  Propanoate metabolism
ypm00660  C5-Branched dibasic acid metabolism
ypm01100  Metabolic pathways
ypm01110  Biosynthesis of secondary metabolites
ypm01120  Microbial metabolism in diverse environments
ypm01130  Biosynthesis of antibiotics
ypm01200  Carbon metabolism
Module
ypm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ypm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ypm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YP_1041 (sucC)
   00640 Propanoate metabolism
    YP_1041 (sucC)
   00660 C5-Branched dibasic acid metabolism
    YP_1041 (sucC)
Enzymes [BR:ypm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     YP_1041 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AAS61291
UniProt: Q8ZH00
Position
complement(1120583..1121749)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGMPAPTGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KLVNSKEDIRAFAEQWLGKKLVTYQTDANGQPVHQILVEAATDIDKELYLGAVIDRSSRR
VVFMASTEGGVEIEKVAEETPELIHKIALDPLTGPQPYQGRELAFKLGLTGKQVGQFTKI
FMGLATLFLERDLAMVEINPLVVTKQGDLICLDGKLGADGNALFRQPELREMRDPSQEDA
REAHAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDKVKAVFVNIFGGIVRCDLIADGIIGAVEEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAATSLTDAAQQVVAAVGAK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgaatatcaggcaaaacaactgtttgctcggtatggcatgccagctcca
actggctacgcctgtaccactccgcgtgaagcagaagaagccgcatctaaaattggtgca
ggcccgtgggtggttaaatgtcaggttcatgcgggcggccgcggtaaagcggggggcgta
aaactggttaacagcaaagaagatattcgtgctttcgctgaacagtggctaggtaaaaaa
ctggtcacttaccaaacagatgccaacggacagccggtgcatcagatcttggttgaagca
gccacggatattgataaagaactgtatctgggggcggttatcgatcgcagctctcgccgt
gtggtctttatggcatccactgaaggtggtgttgaaattgaaaaagtcgccgaagagaca
cctgaactgatccataaaatcgcattagatccattgaccggaccacagccttaccaaggg
cgtgagctggcatttaaattgggcttgaccggtaaacaagtcggtcagttcaccaagatc
tttatggggctggcaacactgttcctggaacgtgacctggcgatggtagagattaacccg
ttggtggtcactaagcagggcgatctgatttgtctggatggtaagctcggtgccgatggc
aatgccttgttccgtcagccggaactgcgtgaaatgcgcgatccaagccaagaagatgct
cgcgaagcacatgctgcccagtgggaactgaactatgtggcgttagatggcaacatcggt
tgcatggtaaacggtgccggtttggcgatgggaaccatggacatcgtgaaacttcatggt
ggcgaacccgctaacttccttgatgtgggcggtggtgcaacaaaagagcgcgtgaccgaa
gcgttcaaaatcattctgtctgacgataaagtgaaagcggtttttgttaatatcttcggc
ggtatcgtgcgttgtgacctcattgctgacggcatcattggtgcagttgaagaagtgggc
gttaacgtacccgttgttgttcgtctcgaaggtaataatgcagagctgggtgccaagaaa
ctggcagacagcggtttgaatatcattgctgcgaccagcctgacagatgcggctcagcaa
gttgtagcggcagtgggggctaaataa

DBGET integrated database retrieval system