KEGG   Yersinia pestis 91001 (biovar Microtus): YP_1046Help
Entry
YP_1046           CDS       T00165                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm00020  Citrate cycle (TCA cycle)
ypm00190  Oxidative phosphorylation
ypm00650  Butanoate metabolism
ypm01100  Metabolic pathways
ypm01110  Biosynthesis of secondary metabolites
ypm01120  Microbial metabolism in diverse environments
ypm01130  Biosynthesis of antibiotics
ypm01200  Carbon metabolism
Module
ypm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ypm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ypm_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ypm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YP_1046 (sdhD)
   00650 Butanoate metabolism
    YP_1046 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    YP_1046 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: AAS61296
UniProt: A0A0H2W2R7
Position
complement(1128811..1129158)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDWLLLRASAIVITLYVFYILGFVVIVPDITYEIWRGFFASHITKVF
TLLTLLSILAHAWIGLWQVLTDYIKPLAIRLVLQLVVVITLLVYLLYGTIVVWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaatgcttctgcgttagggcgtaatggagtacacgattggttgttactgcgt
gcttctgcaatcgtcatcaccctgtatgtcttttatattctgggcttcgttgtgattgtc
ccagacatcacctatgaaatctggcgcggtttcttcgcgtcacacatcacaaaagtattt
acgctgctgacattgctgtcgattctagctcacgcttggatcggtctatggcaggtattg
acggactatataaagccactggcgatacgactggtgttacaactggtcgtcgtgattacg
ctgttggtttatttattgtatggaacaattgtggtgtggggagcttaa

DBGET integrated database retrieval system