KEGG   Yersinia pestis 91001 (biovar Microtus): YP_1090Help
Entry
YP_1090           CDS       T00165                                 

Gene name
asnB
Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ypm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YP_1090 (asnB)
Enzymes [BR:ypm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     YP_1090 (asnB)
Peptidases [BR:ypm01002]
 Cysteine Peptidases
  Family C44
   YP_1090 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1170191..1171855
Genome map
AA seq 554 aa AA seqDB search
MCSIFGVLELKTDPIELRKKALEMSRLMRHRGPDWSGVWANDKAILAHERLSIVDVNTGA
QPLYNAAHTHILAVNGEIYNHQALRQQYSDRYAFQTGSDCEVILALYQEKGPAFLDDLQG
MFAFVLYDTEKDAYLIGRDHLGIIPLYMGHDEHGNMFVASEMKALVPVCRTIKEFPAGSY
LWSQDGEIREYYHRDWFDYDHVKDNVTDKIQLANALEDAVKSHLMSDVPYGVLLSGGLDS
SVISAITKKFAARRVEDNERSEAWWPQLHSFAVGLIGSPDLRAAQEVANHLGTVHHEIHF
TVQEGLDAIRDVIYHIETYDVTTIRASTPMYLMSRKIKAMGIKMVLSGEGSDEVFGGYLY
FHKAPNAKELHEETVRKLLALHMYDCARANKAMSAWGVEARVPFLDKNFLDVAMRINPQD
KMCGNGKMEKHILRECFESYLPHSVAWRQKEQFSDGVGYSWIDTLKEKAAEQVTDQQMET
AHFRFPYNTPGSKEGYLYREIFEELFPLPSAAECVPGGPSVACSSAKAIEWDESFKNMDD
PSGRAVGVHQDAYK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttctattttcggggtcttagagcttaaaaccgaccctattgaattacgcaagaaa
gcgctagaaatgtcacgtttgatgcgtcaccgtggcccagactggtctggtgtctgggcg
aatgataaagccatcctcgcccatgagcgcttatctattgttgacgtcaataccggtgcc
cagccgctgtataatgccgcccacacacatatcttggccgtgaatggtgaaatttataat
catcaagcattacgtcagcaatatagcgaccgttacgccttccaaacgggttcagactgt
gaagttattctggcgttgtatcaagaaaaagggcccgcgttcctcgatgatctgcaaggg
atgtttgccttcgtcctatacgataccgagaaagacgcctacctgatcggccgtgaccat
ttaggtattatcccgctgtatatggggcacgacgaacacggcaatatgtttgtagcttcg
gaaatgaaagccttggtacccgtttgccgcaccataaaagaattccctgctggcagctat
ttgtggagtcaggatggcgagatccgcgaatactatcatcgcgattggtttgattacgac
cacgtcaaagacaacgtaaccgacaaaatccaacttgccaacgcattggaagatgcggtt
aaaagccatctgatgtccgatgtcccttatggggtattgctgtctggtggcctggattca
tccgttatctctgctatcaccaaaaaatttgccgcccgccgtgtagaagataatgaacgc
agcgaagcctggtggccacaactgcactccttcgccgtcggtttgattggctcacccgat
ttacgcgcagcacaagaagtcgctaaccacttgggcacggtacaccatgaaattcatttc
accgtgcaggaagggctggatgccatccgcgatgtgatttatcacatcgaaacctatgat
gtgacgactatccgcgcgtcaacgccgatgtacctgatgtcacgtaaaatcaaagccatg
ggcatcaaaatggtgctatctggtgagggttctgacgaagtcttcggtgggtatctctat
ttccacaaagcgcccaacgccaaagaattacatgaagaaaccgtgcgtaaactgttagct
ctccatatgtatgactgcgcccgtgccaacaaagcgatgtcagcttggggcgttgaagct
cgtgtgcccttccttgataaaaacttccttgatgtcgccatgcgtatcaatccacaggat
aaaatgtgcggcaatggcaaaatggagaaacatatcctgcgagaatgtttcgaatcttac
ctgccacacagcgtcgcctggcgtcagaaagaacaattctctgatggtgttggctatagc
tggattgacaccttgaaagagaaagcagccgagcaagtcactgaccaacagatggaaacc
gctcacttccgcttcccgtacaacacacctggctcgaaagaagggtatttgtaccgtgaa
atctttgaagagctgttcccgctacctagtgcggcggaatgtgtccctggcggcccctct
gttgcctgttcatcagctaaagccattgaatgggatgaatcattcaaaaatatggatgat
ccatcaggccgtgcggttggcgtccatcaggatgcttacaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system