KEGG   Yersinia pestis 91001 (biovar Microtus): YP_1469Help
Entry
YP_1469           CDS       T00165                                 

Gene name
galA
Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ypm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    YP_1469 (galA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    YP_1469 (galA)
   00600 Sphingolipid metabolism
    YP_1469 (galA)
Enzymes [BR:ypm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     YP_1469 (galA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1629034..1631214)
Genome map
AA seq 726 aa AA seqDB search
MSPPCHHLEQIFVFTGAIMNTTFVRLSSRSSDMIVRCSPYAEIVYWGKPLLDYSPAMMEA
LNRPVANSRLDSDIPLTLCPENGRGLFSVPGMEGNRDGEDWSPIFTSQSHTLENNLLTII
SEDTSAGLRLVSELQMCPDSGVIKTRNTLTNIKAGCYRIDRLAVTLPFPERANEIMAFNG
RWIKEFQRHSLKLDHGGYIQENRRGRTSHEYFPGMVVGKAGFSEQQGEVWGLHLALSGNH
RLRADCKSDGRRQVQAEALYFSGEIVLEHLQSVSTPWVYATYSATGLNGMSHSFHHYVRQ
NIVPSLAEKPRPVHLNTWEGIYFKHDPDYIIQMVKNAAKIGVERFIIDDGWFKGRNNDLS
SLGDWYIDAEKYPQGLNPIIEAVNEYGMEFGIWVEPEMINQDSDLYRNHPDWVLKLDGYP
LLKGRDQLLLDLSNPAVFDYLLERLSWLLGEHKVDYVKWDFNREMVQPGHRGHPSLVQQT
EQLYRLFDQLNLHFPHIEFESCASGGGRIDYEILQRCHRFWPSDSNDALDRQQIQRGMSY
FFPPEVMGAHIGGTPCHTTARMHSINFRGLTALFGHMGVELDPVSESPAEQQAFARYIAL
HKQLRPLLHSGNTIRLDHPDKTTLINAVIAHDQQQAVVLISQLALPEYALCGNVLIPGLN
PSTHYQIEVLDMPDSMHKPRNNTMKRYPAWLKSPLIVSGDWLEKAGIALPILNPESAILI
QLSAVN
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgccgccatgccatcacctcgagcaaattttcgttttcacaggagccattatgaat
actacctttgtcagattatccagccgttcttctgacatgatcgtgcgctgctctccctac
gcagaaattgtttactggggtaagcctctgcttgattactcgcctgcgatgatggaagcc
ttaaaccgcccggtcgctaacagccgcctggacagcgatataccgttgacgctctgccct
gaaaatggccgagggctgttcagcgtgcccggtatggagggaaaccgtgatggcgaagat
tggtctcccattttcaccagccagagccatacacttgaaaacaatttattaacgattatt
agcgaagatacgagcgcgggcttgcggctggtgagtgagttgcagatgtgcccagacagt
ggcgtgataaaaacccgcaatacgctgaccaatattaaagccggatgctaccgaatcgat
cggttggccgtgaccttgccttttccggaacgtgccaatgaaatcatggccttcaatggc
cgttggattaaagagttccagcgccactcacttaaactcgatcatggcggttatattcag
gaaaatcggcgcggcagaacctcacatgaatattttcccggcatggtagtagggaaagca
ggcttcagtgagcaacagggcgaggtctggggcttgcatctggccttgagtggaaaccat
cgtttacgcgctgactgtaaaagtgatggccgccgtcaggtgcaggccgaagccctctat
ttttccggtgaaatcgttctggaacacttgcaaagtgtcagtaccccgtgggtctacgcg
acctattccgctaccgggttgaacggtatgagccacagttttcatcactatgtgcgccag
aatatcgtgccatcactggcagaaaaaccgcgcccggtgcacctcaatacttgggaaggc
atctattttaagcatgacccagactacattattcagatggtgaaaaacgcggccaaaatt
ggtgtggagcgctttatcattgatgatggctggttcaaaggacgcaacaacgatttaagt
tcactgggcgattggtatattgatgccgaaaaatacccacaggggctgaaccccattatt
gaagcagtgaatgaatacggtatggagtttggtatctgggtggaacctgaaatgatcaat
caggattctgatttataccgtaatcatcctgactgggtgctgaaacttgacggctacccg
ctactgaaaggacgcgaccaactgttgctcgatttgtcgaacccggccgttttcgactac
ctgctagaacgcttgagctggttgttgggcgaacacaaagttgactatgttaaatgggat
ttcaaccgcgagatggtccagcccggtcaccgcggccacccttcgttggtacaacagacc
gagcaactgtatcgcttattcgaccaactcaacctgcatttcccacatattgaatttgaa
tcctgcgcgtcaggcggggggcgtattgattatgaaattctgcaacgctgccaccgtttc
tggccatcagacagcaacgacgctcttgatcgccagcaaattcagcgagggatgagctac
ttcttccctccagaagttatgggcgcgcatattggcggtactccgtgccataccaccgcc
agaatgcactctattaattttcgggggctgacagcgctgttcggccatatgggggtcgag
cttgatccggtgagtgaatctcctgccgagcaacaggcttttgcccgttatattgcgcta
cataaacaactgcggccgctgttacatagcggaaacacgatccggctcgaccatccggat
aaaacaacattaattaatgccgttatcgcacacgaccagcagcaagctgtcgtcctgatc
agccagctagcactaccggaatatgccttatgtggcaacgtattgattcctggtcttaac
ccatccacacactatcagatcgaggttctggacatgcctgacagcatgcacaaaccacga
aataacaccatgaagcgctatccagcctggttgaaaagcccgctcatcgtcagtggcgat
tggctagagaaagcaggaattgcccttcccatcctcaatcctgaatcggctatcctgata
cagctttcagccgtaaattaa

DBGET integrated database retrieval system