KEGG   Yersinia pestis 91001 (biovar Microtus): YP_1682Help
Entry
YP_1682           CDS       T00165                                 

Gene name
glsA1
Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YP_1682 (glsA1)
   00330 Arginine and proline metabolism
    YP_1682 (glsA1)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    YP_1682 (glsA1)
Enzymes [BR:ypm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     YP_1682 (glsA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1855405..1856427
Genome map
AA seq 340 aa AA seqDB search
MEITDMPTDDSNNGIIDYVSTGHLPDPETVVKLVQEAHKRFSTDTAGVVSNVYPALERIP
ADLFGICMVGTNGKIHSAGDVDYEFTIMSVSKPFVFALVCQAIGAKTAREKLGVNSTGMA
FNSVTAIERASDGRTNPMVNSGAIATTSLVPGATSDEQWKFIYDGLCRFAGRELTLNEEV
YQSACETNFRNRGIANVLQGYGRLGCDPIIATDLYTRQCSLNVSARDLAVMGATLADGGV
NPLTRERVVDNDICHYALAVMVTAGLYETSGDWLYDIGLPGKSGIGGGIVTVSPGKGGLG
TFAPLLDSAGNSIKGQLAARFLSRSLGMDMFVSEPYTEKN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggagataacagatatgccgacagatgatagcaataacggaattatcgactacgtatca
acaggtcatctacctgacccggaaacagtcgttaaattagtgcaagaagcccataagcga
tttagtacggatactgctggtgtggtttctaatgtttatccggcattagagagaattcct
gctgatctctttggcatttgcatggttggcactaacggcaaaatccactctgctggcgat
gtggattatgaatttaccattatgagtgtttccaaacccttcgtttttgcactggtttgt
caggctattggggcgaagaccgcccgtgaaaaactcggggttaacagtaccggtatggcg
tttaactcggtaacggccattgagcgggcatcggatggccgtacaaatccaatggttaac
tcgggtgcgattgcgacgaccagtctggttcctggcgcgaccagtgatgaacaatggaaa
ttcatttatgacggtttgtgccgctttgctggccgcgaattaacactgaatgaagaagta
taccaatcggcttgtgaaaccaatttccgtaatcgcggtatcgctaatgtgctgcaaggt
tatgggcgtctggggtgtgatcctattatcgccactgatctctatacccgccagtgttca
ctgaatgtcagtgcccgagatctggctgtgatgggcgcgacattagcggacggcggcgtt
aacccactgactcgtgagcgagtggtggacaatgatatctgccattatgcattagccgtc
atggtaacggcagggctgtatgagacctctggagactggctctacgatattggcctgccc
ggtaaaagcggcattggcggtggaattgtgacagtgtcacctggcaagggagggttgggg
acgttcgcaccgttactcgacagtgcgggtaacagtatcaaagggcaacttgctgctcgg
ttcttatcacgcagtctcgggatggatatgttcgtttctgagccttacaccgaaaagaat
tga

DBGET integrated database retrieval system