KEGG   Yersinia pestis 91001 (biovar Microtus): YP_2002Help
Entry
YP_2002           CDS       T00165                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ypm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YP_2002 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YP_2002 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YP_2002 (trpB)
Enzymes [BR:ypm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     YP_2002 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2224098..2225384)
Genome map
AA seq 428 aa AA seqDB search
MASQLTPLRLQIPRGYELTLVNPINQRITDRKMTTLNPYFGEFGGMYVPQILVPALKQLE
DAFVSAQLDPEFQAAFQDLLKNYAGRPTALTLCQNLTKGTKTKLYLKREDLLHGGAHKTN
QVLGQALLAKRMGKTEIIAETGAGQHGVASALACALLGLKCRIYMGAKDIERQSPNVFRM
RLMGAEVIPVHSGSSTLKDACNEALRDWSGTYETAHYMLGTAAGPHPYPTIVREFQRMIG
EETKAQILEKEGRLPDAVLACVGGGSNAIGMFADFIDEPDVGLIGVEPAGLGIETGQHGA
PLKHGKVGIYFGMKSPMMQTSDGQIEESYSISAGLDFPSVGPQHAYLNSIGRADYVSITD
DEALDAFKTLSCKEGIIPALESSHALAHALKMIKADPDKEQILVVNLSGRGDKDIFTVHD
ILKARGEI
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
ttggcgtcgcagctaacaccactgcggcttcaaataccaaggggatatgaacttactttg
gttaacccgataaaccaacgcataacggacagaaaaatgacgacacttaatccctatttt
ggcgaatttggcggtatgtatgtgccccaaattttagtgccagccctgaagcaactggaa
gacgcattcgtcagtgctcaactggatcctgaatttcaggccgcatttcaagatttgtta
aaaaactatgccggtcgccctaccgccctgaccttgtgtcaaaatctgaccaaagggaca
aagaccaagctatatctgaaacgtgaagatctgctgcacggcggtgcacacaaaaccaac
caggttttaggtcaggctttattagctaaacgcatgggtaaaactgaaattattgccgaa
accggtgccggccagcacggggttgcctccgcactggcttgtgcattgctgggtttaaaa
tgccgcatttatatgggggcgaaagatattgaacgtcagtcgcctaacgttttccgtatg
cgcctgatgggagccgaggttattccagtgcatagtggttcatcgacgctgaaagatgcc
tgtaatgaagcgctacgtgactggtcaggtacttatgaaaccgctcactatatgctgggt
accgccgctggccctcacccttacccgacaattgtgcgcgaattccaacgcatgatcggt
gaagaaaccaaggctcagatactggaaaaagaaggccgcctgcccgatgcagtattggcc
tgtgttggtggcggttctaatgctatcggtatgtttgctgattttattgatgagcctgat
gtgggtctgattggcgtagagcctgccggcttggggatcgaaaccgggcaacatggtgcc
cccctaaaacacggtaaggtcggtatctacttcggtatgaaatcaccgatgatgcagacc
agcgatgggcaaattgaagaatcttactctatttctgccggtctggacttcccctctgtg
gggccgcaacatgcttatttgaacagtattgggcgggctgattatgtctccattaccgat
gatgaggctttagacgcatttaagacattgtcatgtaaagaagggattattccagcgcta
gagtcctctcatgctctggcacatgcgttgaaaatgattaaagcggatccggataaagaa
caaatactggtggtgaatctctccggccggggtgacaaagatattttcaccgttcacgat
attctgaaagcacggggagagatttaa

DBGET integrated database retrieval system