KEGG   Yersinia pestis 91001 (biovar Microtus): YP_2239Help
Entry
YP_2239           CDS       T00165                                 

Gene name
bglX1
Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ypm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    YP_2239 (bglX1)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    YP_2239 (bglX1)
Enzymes [BR:ypm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     YP_2239 (bglX1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2487271..2488308)
Genome map
AA seq 345 aa AA seqDB search
MTVGPVMLDVASYELDAEEREILKHPLVGGLILFSRNFHDAEQLRELVRQIRAASHERLV
VAVDQEGGRVQRFRDGFTRLPAAQYFAAINDAATAAQLAQEAGWLMAAEMMAMDIDISFA
PVLDIGHVSAAIGERSFHSDPQQARIMAECFIRGMHSAGMKTTGKHFPGHGAVTADSHKE
TPHDNRPLAEIRTHDMVIFRELIQRKLLDAIMPAHVIYTEADARPASGSAYWLQEILRQE
LGFEGIIFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRQGAVSVLDNLSPIKAD
QLTRLYHSGQFDRQTLMASSRWQQANKALTALSERWDAHKQTLGQ
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtgggtcccgtgatgttagatgttgccagctatgagctggatgctgaagagcgt
gagattttaaaacacccactggtgggagggttgatcttattcagccgtaattttcatgat
gcggagcagttacgcgaattagtacgccaaatccgtgcagcatcgcatgaacgtttggtg
gtcgcagtggatcaggaaggggggcgggtccaacgctttcgtgacggttttacccgcctg
ccagcggctcagtatttcgcggctatcaatgatgccgctactgcggctcaactggcgcaa
gaggcggggtggttgatggcagcagaaatgatggcgatggatatcgatatcagttttgct
ccagtactggatattggccatgtcagcgccgcaattggtgagcgttcattccacagtgat
ccacaacaggcgcggataatggcggagtgtttcatccgtgggatgcacagtgcagggatg
aaaaccacgggcaagcattttccagggcacggcgcagtaaccgcagattcacataaagag
acgccacatgataatcggccactggcagaaatccgtactcatgatatggttatatttcgt
gaattgatccagcggaaattactggatgcgattatgcctgctcacgtgatttataccgaa
gccgatgcacggcctgccagcggttctgcctattggttacaagagatattgcgccaagag
ctagggttcgagggcatcattttctctgatgatctctcgatggaaggggctgcgatcatg
ggcagttacgccgagcgcggccaggcatcgttggatgccggttgcgatatgattttggtg
tgtaataaccgtcagggggccgtgagtgtgctggataatctgtctccgatcaaagccgac
caactgacccgtttgtaccattcagggcaatttgaccgtcagacattgatggcttcatcc
cgttggcaacaggcgaataaagcattaacggcactcagcgaacgttgggatgcacataaa
caaacgttggggcaatag

DBGET integrated database retrieval system