KEGG   Yersinia pestis 91001 (biovar Microtus): YP_2338Help
Entry
YP_2338           CDS       T00165                                 

Gene name
menD
Definition
2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase (EC:2.2.1.9 4.1.1.71)
Orthology
K02551  
2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase [EC:2.2.1.9]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ypm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    YP_2338 (menD)
Enzymes [BR:ypm01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     YP_2338 (menD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2600048..2601751)
Genome map
AA seq 567 aa AA seqDB search
MSTSVFNRRWAALLLEALTRHGVRHICIAPGSRSTPLTLAAAANPSLVCHTHFDERGLGH
LALGLAKASTEPVAVIVTSGTAVANLYPALIEAGLTGERLILLTADRPPELIDCGANQAI
RQQGLFASHPTLSVNLPRPTPDISARWLVSTLDSAMAQLQHGALHINCPFAEPLYGGDEQ
QYADWSASLGDWWQDCHPWLRQTCYPPSLYQPPAQQADWFFWRQKRGVVIAGRMGAQEGR
QLTAWAAMLGWPLIGDVLSQTGQPLPCADLWLAHPRAQETLAQAQMVLQFGSSLTSKRLL
QWQTACQPQEYWLVDSAPGRLDPANHRGRRIICPVGEWLSRHPAQRRTPWATELAAYSES
AQAQVIETLAGQFSEAAVAHQLAELLPDNGQLFVGNSLIVRLIDALGQLPAGYPVYSNRG
ASGIDGLLSTAAGVQRATAKPTLAIVGDLSALYDLNALALLRQSSAPMVLLVINNNGGQI
FSLLPTPEAERQRFYCMPQDVNFEHAAVMFSLGYARPNSWPQLRELVHQCWLRGGTTLIE
VQVPPSQGAETLQQLVQQVTLIPQVAP
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacaagtgtttttaaccgtcgttgggcggcactgctactggaggctttgacccgc
cacggtgtgcgtcatatctgtattgccccagggtctcgctctacaccgttaacgttagcg
gctgccgctaatccgtcgttggtttgccatacccattttgatgagcgcggtctgggccat
ctggctctggggctggcgaaggcctcaacagaaccggtggcggtcattgtcacctcgggt
acggcggtggcgaatctttatcctgcgctaatcgaagcggggttaacgggtgagcggctg
atattattgaccgctgatcgcccaccggagttaatcgattgcggtgccaatcaggctatc
cgccagcaggggctgtttgccagccatccaaccctaagtgttaatctccccagaccgacg
cccgatatctctgcccgttggttggtttccacactcgacagcgcgatggcgcaattgcaa
catggcgctttgcacattaattgtccctttgctgaaccactgtatgggggggatgagcaa
cagtatgccgactggtctgcctcgctgggcgattggtggcaggattgtcacccatggctg
cgtcaaacctgttacccgccctctctttatcaaccaccagcacagcaagctgactggttt
ttctggcggcaaaaacgtggcgtcgtgattgccggacggatgggcgcgcaagagggtagg
caactgaccgcatgggctgcaatgctgggctggccactgattggcgatgtattgtcacaa
accggtcagccattgccttgtgctgacttatggctggcgcacccacgggcgcaagaaacc
ctcgctcaagcacagatggtgttgcaatttggcagcagtctgaccagtaagcgcctttta
caatggcagaccgcatgtcagccacaggaatactggctggtggatagcgccccaggccgc
cttgatcctgctaaccatcgtggccgacgtattatttgcccggtgggcgagtggttgagt
cggcaccccgcgcagcggcgtacaccttgggccacggaactggcggcatattcggaaagt
gcgcaagcacaggtgatcgagacgctggccggccaattcagtgaggccgccgtggcacat
cagctcgcggaattattaccggataacggccagctatttgttggcaacagtttgattgtc
cggttgattgatgcgctggggcagctacccgcaggctatccggtttacagcaatcggggg
gccagcggtatcgatggtttgctgtcaaccgccgccggtgtacagcgcgcgacggcgaaa
ccgacattagctatcgtcggtgatttgtctgccttatatgaccttaatgcgctggcactt
ttgcgccagagctcggcaccgatggtgctactggtgatcaataacaatggggggcagatt
ttctctttattgccaacgccagaggccgagcgccagcgtttctactgtatgccgcaggat
gtgaacttcgaacacgcggcggttatgttcagcttaggttatgctcgccctaatagctgg
cctcagctacgggagctagtgcatcaatgctggctacgggggggaaccacgctgattgaa
gtccaggtgccaccaagtcagggggcagaaacactgcaacagttagtacaacaggtgaca
ttaataccgcaggtggccccatga

  All links  
No link information was found.   
DBGET integrated database retrieval system