KEGG   Yersinia pestis 91001 (biovar Microtus): YP_2369Help
Entry
YP_2369           CDS       T00165                                 

Gene name
aat2
Definition
aminotransferase (EC:2.6.1.2)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:ypm01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ypm01230]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ypm00250]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:ypm00290]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2636900..2638114
Genome map
AA seq 404 aa AA seqDB search
MSPIEKSSKLDNVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFDAPDEILVDVIR
NLPTAQGYCDSKGLFSARKAIMQHYQARNIRDLTVEDIYIGNGVSELIVQSMQALLNLGD
EMLVPAPDYPLWTAAVSLSSGKAIHYMCDEESGWFPDLDDIRSKITPRTRGIVIINPNNP
TGAVYSKELLLEIVEIARQNDLIIFADEIYDKILYDDAQHHSIAALAPDLLTVTFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPMQHAIQTALGGYQSISEFI
QPGGRLYEQRDRAWELINQIPGVSCVKPQGALYMFPRIDQKRFNLKDDQKLVLDLLLQEK
VLLVQGSAFNWPYPDHVRIVTLPRVDELEMAVRKLGRFLETYHQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccattgagaaatccagcaaactggacaacgtctgttatgacattcgtggaccg
gtgctaaaagaagctaagcgtcttgaagaggaaggtaacaaggttctgaaactgaacatc
ggcaaccctgccccgtttggtttcgatgcacccgacgagattctggtggatgtaatccgt
aatttaccgaccgcacaaggctattgcgactccaaaggcttgttttcggcacgtaaagcc
attatgcaacactatcaagcccgcaatatccgtgatctgacggtcgaggatatctacatt
ggaaacggtgtttccgagttgatcgttcaatccatgcaagcattactgaatttgggtgat
gaaatgctagtacccgcaccggattacccgctgtggacagctgccgtgtcgctctcaagt
ggtaaagcgattcattatatgtgtgatgaagagtcaggctggttccctgatttggatgat
attcgcagcaaaatcactccgcgtacccgtgggattgtgattatcaacccgaataaccca
accggtgcggtatacagcaaagagctgctgttagaaattgttgaaattgctcgccagaat
gacctaattattttcgctgatgagatctacgataaaattttgtatgacgatgctcagcac
cattcgatcgccgcattagcccctgatttgctgaccgttacgttcaatgggctgtctaaa
acataccgtgttgcgggtttccgccagggctggatggtgttgaacgggccgaaaaagcac
gctaaagggtatattgaaggcttggaaatgctggcatcgatgcgtttgtgcgccaacgta
ccaatgcagcatgcgattcaaaccgccttgggcggctatcagagcattagtgagtttatc
caacctggtggccgtttgtacgagcagcgtgatcgggcctgggagcttatcaaccaaatc
cccggtgtttcctgtgtgaaacctcagggcgcgttgtatatgttcccacgtattgatcag
aaacgttttaacctgaaagacgaccagaagttggtattggatctgttgttgcaagagaaa
gtgctattggtgcaaggtagcgcctttaactggccgtacccggaccatgtgcggatcgtc
acgctgccacgggtggatgagctagagatggcggtgaggaagctggggcggttcttagag
acgtatcatcagtaa

DBGET integrated database retrieval system