KEGG   Yersinia pestis 91001 (biovar Microtus): YP_2417Help
Entry
YP_2417           CDS       T00165                                 

Gene name
faoA
Definition
(GenBank) putative fatty oxidation complex alpha subunit, enoyl-CoA hydratase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm00071  Fatty acid degradation
ypm00280  Valine, leucine and isoleucine degradation
ypm00281  Geraniol degradation
ypm00310  Lysine degradation
ypm00362  Benzoate degradation
ypm00380  Tryptophan metabolism
ypm00410  beta-Alanine metabolism
ypm00640  Propanoate metabolism
ypm00650  Butanoate metabolism
ypm00903  Limonene and pinene degradation
ypm00930  Caprolactam degradation
ypm01040  Biosynthesis of unsaturated fatty acids
ypm01100  Metabolic pathways
ypm01110  Biosynthesis of secondary metabolites
ypm01120  Microbial metabolism in diverse environments
ypm01130  Biosynthesis of antibiotics
ypm01200  Carbon metabolism
ypm01212  Fatty acid metabolism
Module
ypm_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ypm00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    YP_2417 (faoA)
   00650 Butanoate metabolism
    YP_2417 (faoA)
  Lipid metabolism
   00071 Fatty acid degradation
    YP_2417 (faoA)
   01040 Biosynthesis of unsaturated fatty acids
    YP_2417 (faoA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YP_2417 (faoA)
   00310 Lysine degradation
    YP_2417 (faoA)
   00380 Tryptophan metabolism
    YP_2417 (faoA)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YP_2417 (faoA)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    YP_2417 (faoA)
   00281 Geraniol degradation
    YP_2417 (faoA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    YP_2417 (faoA)
   00930 Caprolactam degradation
    YP_2417 (faoA)
Enzymes [BR:ypm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     YP_2417 (faoA)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     YP_2417 (faoA)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     YP_2417 (faoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AAS62622
UniProt: Q8ZD45
Position
complement(2686079..2688406)
Genome map
AA seq 775 aa AA seqDB search
MMSKENIVTRENTAVSENAVSEPTVNNDVGASATNSVTHPAFTLNVRPDNIGIITIDVVG
DKVNTLKAEFADQIATILQQAHALPKLQGLVIVSGKPDSFIAGADITMIAACRTAHDARV
LAQKGQSILAQIAAFPVPVVAAIHGACLGGGLELALACHSRICSLDDKTVLGLPEVQLGL
LPGSGGTQRLPRLVGVSKALDMILTGKQIRPRQALKMGLVDDVVPRDILLDVAIQRAKAG
WLNRRALPWQERLLSGPLGKALLFRIVRKKTLAKTRGHYPAAERIIDVVRKGLDQGGPSG
YEAEARAFGELAMSPQSAALRSLFFATTSLKKETGSAATARAIHRVGVLGGGLMGGGIAN
VTATRAGLPVRIKDINPQGINQALKYTWDALGKRVRSKRMRPTEQQRQMMLISGSTDYRG
FERVDIVVEAVFEDLSLKQQMVADIERFGAAHTIFASNTSSLPISQIAALAQRPEQVIGL
HYFSPVDKMPLVEVIPHEKTSEETIATTVALARKQGKTAIVVADRAGFYVNRILAPYINE
AARCLLDGEPIESVDNALVDFGFPVGPMMLLDEVGIDVATKIMPILVEQLGPRFAAPPSF
DVILKDGRKGRKNGRGFYLYSNPTKNSSPTKNGNSPAKRNSFKWRKNKVKPVDASIYTLL
GVTPKAHLGAGVITQRCTMLMLNEAVRCLDESIIRNPRDGDIGAVFGIGFPPFLGGPFRY
LDSLGADKVVQALRLLVQQYGERFEPCQRLVTMAEQQQQFYPVDANIDEVTDVAS
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
gtgatgagcaaggaaaatatcgttacccgtgaaaatacagctgtcagtgaaaatgcagtc
agtgaacctacagtgaataatgatgtgggcgcatcggccacgaattcagttacccatccc
gcatttaccctcaacgtaaggccggacaatattggcattatcaccattgatgttgttggt
gacaaagtgaataccctaaaggctgaatttgctgatcaaattgccactatattgcaacaa
gcgcacgctctaccaaaattacagggactcgtcattgtttctggcaaaccagactccttc
attgccggtgcggatatcacgatgatcgcggcttgtcgtaccgctcacgacgcccgcgta
ttagcacaaaaaggccaatcaattttggcgcaaattgccgctttccctgtgccggttgtg
gctgcgattcatggcgcttgtctggggggagggctagagctggcgctggcttgccatagc
cgcatatgttctctggatgataaaaccgttctcgggctaccggaggtgcaactggggtta
ctgcctggctccggcgggacgcaacgtctgccgcgtttagtgggggtcagtaaagcactg
gatatgatattgaccggtaaacagatacggccccgtcaggcactaaaaatggggctggtg
gatgatgttgtgccacgcgatatcttattggatgtggcgattcagcgcgcgaaagcgggg
tggcttaatcgacgagcattaccatggcaggagcgtttactcagtgggccgttgggtaaa
gctttattattccgtattgtccgtaaaaaaacgctagctaaaacgcgggggcactacccg
gcggctgaacgtattattgatgtggtgcgtaaaggattagatcagggcgggccaagtggt
tatgaggcagaagccagagcatttggcgagttggcgatgtcgcctcagtcagccgcatta
cgcagcctgttttttgccacgacgtcactgaaaaaagagaccggaagtgcagccacagcg
cgtgcaattcatcgggtcggcgtattgggcggtggcttgatgggcggaggtattgccaac
gtaacggctacccgagcgggcttgccagtgcgtatcaaagatatcaatccgcaaggaatt
aatcaggcgctgaaatatacctgggacgcattgggtaaacgggttcgtagtaagcggatg
cgcccaactgaacagcagcggcagatgatgttgatctctggtagtacggattaccgtggt
tttgaacgtgtcgatattgtggtggaagcggtatttgaggatttatcactgaagcagcaa
atggttgctgacatcgaacgatttggtgccgcccatactatttttgcctccaatacatca
tcactccccatcagccagattgctgctttggcgcaacggccagagcaggttattggcctg
cactattttagtccagtagataaaatgccactggttgaagtcatcccccatgaaaaaacc
agtgaagagaccatcgctaccaccgttgctttagcccggaaacagggtaaaacagccatt
gtggtggctgatcgcgctgggttctatgtaaaccgcattttggcaccttatattaatgaa
gctgcccgttgcctgctcgacggagagcctatcgaatcagttgataacgcgttggtcgat
tttggtttccccgtaggccccatgatgctgcttgatgaggttgggattgatgttgcgacc
aaaataatgccgattctggtcgagcaattagggccgcgttttgctgcgcccccgtcattt
gacgttattttgaaggatggacgtaaagggcgcaaaaatggccgtggcttttatttatat
tcaaaccccacaaaaaattcatctccaacaaaaaatgggaattctccggcgaagcgtaat
agctttaagtggagaaaaaacaaagtaaaaccagtcgatgccagtatctataccttgttg
ggggtgacacctaaagcccatcttggtgcaggcgtgattactcaacgttgtaccatgctg
atgttgaacgaagcggtacgctgtctggatgaatcgatcattcgtaacccgcgcgatggt
gatattggtgcagtgtttgggatcggttttccgcctttcctcggtggtccgttccgctat
ttggatagcctgggagccgataaggtggtacaagcactcagattattggtacagcaatac
ggtgagcgtttcgaaccttgccagcggttggtaacaatggctgaacaacaacaacaattc
tatcccgtggacgccaatatagatgaggtgacggacgtggcaagctga

DBGET integrated database retrieval system