KEGG   Yersinia pestis 91001 (biovar Microtus): YP_2602Help
Entry
YP_2602           CDS       T00165                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm00010  Glycolysis / Gluconeogenesis
ypm00052  Galactose metabolism
ypm00500  Starch and sucrose metabolism
ypm00520  Amino sugar and nucleotide sugar metabolism
ypm00521  Streptomycin biosynthesis
ypm01100  Metabolic pathways
ypm01110  Biosynthesis of secondary metabolites
ypm01120  Microbial metabolism in diverse environments
ypm01130  Biosynthesis of antibiotics
ypm01200  Carbon metabolism
Module
ypm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ypm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ypm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YP_2602 (glk)
   00052 Galactose metabolism
    YP_2602 (glk)
   00500 Starch and sucrose metabolism
    YP_2602 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    YP_2602 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    YP_2602 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    YP_2602 (glk)
Enzymes [BR:ypm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     YP_2602 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C ROK
Motif
Other DBs
NCBI-ProteinID: AAS62795
UniProt: P58619
Position
complement(2884358..2885329)
Genome map
AA seq 323 aa AA seqDB search
MTTYALVGDVGGTNARLALCAVATGEILQAKTYSGLEYESLEDVIKQYLSEHQAKVTDAC
IAIACPITGDWVAMTNHTWAFSIAAMQQNLGLDHLEVINDFTAVSMAIPVLPAQDVLQFG
GTQPQPGKPVAVYGAGTGLGVAHLVNVDRRWISLAGEGGHVDFAPNSEEEDQILAVLRQE
LGHVSAERVLSGPGLVNLYRAIVISDARLPEKLAPKDITARALADSCTDCRRALSLFCVI
MGRFGGNLALNLSTFGGVYIAGGIVPRFMEFFKASGFRAAFEDKGRFKDFLQDIPVYMIT
HPQPGLLGAGAYLRQKLGYELSS
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgacgacttatgccctggtgggtgacgttggcggtacgaatgcccggttggcgctttgc
gctgttgcaacgggcgagatattgcaagcaaagacatattcagggttggaatatgaaagt
ttagaggatgtaatcaaacaatatctatcagagcatcaagccaaggtcaccgatgcttgt
atcgcgattgcctgcccgattaccggggattgggtcgcaatgaccaatcatacttgggca
ttttctattgccgccatgcaacagaatctgggtctggaccatttggaagtgatcaatgac
ttcaccgcagtctccatggctatccccgtgttacctgcccaagatgttctgcaatttggt
ggcacacagccacagcctggcaaaccggtggcagtgtatggcgcaggtactgggctgggg
gtagcacatttagtgaatgttgatcgccgttggattagtttagcgggagagggcgggcat
gttgatttcgcgcctaatagtgaagaagaagaccagattctggccgtattgcgccaggag
ttggggcatgtttccgctgagcgggtgctatctgggccgggcttagtcaatttatatcgg
gcaattgtgatttctgatgcgcgcctaccagagaaactggcaccgaaagatattaccgca
cgggcgctggcggatagctgtaccgattgtcgccgggcattatcactattttgcgtaatt
atgggccgctttgggggcaatttagcccttaacctcagtacgtttggtggcgtttatatt
gcggggggcatcgtgccgcgctttatggagttctttaaagcctctggttttcgcgctgcg
tttgaagataaaggccgttttaaagatttcttacaagatattccggtgtatatgattact
catccacaacccggtttactgggggctggtgcctatttacgccaaaaattggggtatgag
ttgtcaagctaa

DBGET integrated database retrieval system