KEGG   Yersinia pestis 91001 (biovar Microtus): YP_2802Help
Entry
YP_2802           CDS       T00165                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ypm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    YP_2802 (dxr)
Enzymes [BR:ypm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     YP_2802 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3112972..3114117)
Genome map
AA seq 381 aa AA seqDB search
MSVVRANPELFKVTALVAGRNVREMAQQCLEFSPRYAAMSDEHSAKSLRLLLAEQGSDTE
VYSGETAACELAALDDVDQVMAAIVGIAGLPSTLAAIRAGKQVLLANKESLITCGKLFMD
EVKRSRAQLLPIDSEHNAIFQSLPERIQRQLGYSSLNENGVSRIILTGSGGPFRETPLSQ
FSDVTPDQACAHPNWSMGRKISVDSATMMNKGLEYIEARWLFNASAEQIEVVLHPQSVIH
SMVRYHDGSILAQMGTPDMRTPIAHAMAYPMRVSSGVAPLDFCKVGALTFTTPDYQRYPC
LKLAIDACNAGQAATTALNAANEISVMAFLDSKIRFTDIEVINRTVVEGLLLSEPTSVEE
VLVIDRKARDVAAQVIAKLNN
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
ttgagtgttgtgcgtgcaaaccctgaattatttaaagtcacggcgttagttgccgggcgt
aatgtcagggaaatggcgcagcaatgccttgagttctccccccgctatgcagctatgtct
gatgaacactcagctaaatcactgcgtttattgttggcagaacagggttcagacaccgag
gtctattccggtgaaacggctgcctgcgaattggcagctttagatgatgtcgatcaagtg
atggccgcgattgttggcattgctggtttaccctcaacattggccgctattcgtgcaggt
aaacaagtcttgcttgccaataaagagtcgctgattacctgcggtaaactctttatggat
gaggttaaacgcagccgtgctcaattactgccaattgatagcgagcataacgcgattttt
cagagtttgcctgaaagaattcagcgccaattaggctattcttcattaaatgaaaatggc
gtttcacggattattttgactggctctggtggcccatttcgtgaaactccactttcgcag
ttttctgatgtcaccccagatcaagcttgtgctcatccaaattggtctatggggcggaaa
atttctgtcgactcagcgacgatgatgaataaaggcctggagtatattgaggctcgatgg
ttatttaatgccagcgcagaacagatagaggttgtgttacatccgcagtctgttattcac
tcgatggttcgctatcatgacggaagtatcctggcacaaatggggactccagacatgcgg
acaccgattgcacatgcgatggcttacccaatgcgagttagctcaggtgttgcgccattg
gatttttgcaaagtaggcgcgctgacctttacaaccccggattatcaacgttatccgtgc
ttaaagttggccatagacgcctgtaatgcggggcaggcagcgacaacagcgctgaatgca
gcaaatgaaatttcagtcatggcatttttagattcaaaaattcgtttcactgatattgaa
gtgattaaccgtactgttgttgaaggtttattattatcagaacctaccagtgtggaagag
gtgttggtgattgatcgcaaagctcgtgatgtcgcggcccaagtcattgcaaaattaaat
aattaa

DBGET integrated database retrieval system