KEGG   Yersinia pestis 91001 (biovar Microtus): YP_2884Help
Entry
YP_2884           CDS       T00165                                 

Gene name
recD
Definition
exonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ypm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    YP_2884 (recD)
Enzymes [BR:ypm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     YP_2884 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3203642..3205600
Genome map
AA seq 652 aa AA seqDB search
MMTLLAQAARDRLLRPLDVQFSRMIAGDDDPRLQLAAAILSAEVGAGHVCLPLRYLQPEL
LFGGRQPDLSLALWQAAGSPDKAQWLQALQNAPVVSDGSQPTPLVLQQERLYLQRMWQYE
GDVVQFIASDSVFINRDSDFMTSKGIATSVDESLLRETLDALFGCAGSEVDWQKVAAAVA
ATRRISVISGGPGTGKTTTVAKLLTALIRLSQGQRLRIKLAAPTGKAAARLTESLGKAIR
QFFLTDDERKLFPDQASTLHRLLGVQPNSQRLRYHRGNPLNLDVLVVDEASMVDLPMMAR
LIAALPAKAKVIFLGDRDQLASVEAGAVLGDICRFAELGYSEQRAQQLTQLTGYLLTNNA
LTSNVLTNKALANKAQPDETYSDSANVRDSLCLLRKSYRFDEKSGIGQLALAVNAGEYRQ
ALSVLNSAYSDVERFPLADEEDYQVLLEACAVGYQHYLERVAALAPAAEVLAAFGRYQLL
CALRSGPFGVSGLNERIEQVLHRKGFIIRPSGPSGRWYVGRPVMIELNDSALGLFNGDIG
IALHDNEGELRVYFQLPDGNIKSVQPSRLPSHETAYAMTVHKSQGSEFEHTALVLPNTFM
PVLTRELVYTAITRARQHLTLYCSDAVLSHAIRTPTLRLSGLVDRLNTLNRQ
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgctattggctcaggctgctcgagaccgcttattgcgcccactggatgtgcag
ttttcacgaatgattgccggcgatgatgacccgcgattacaactggccgcagcgatcctt
agtgcagaagtaggggccggtcatgtttgcctgccattacgctatttacagccagaactg
ctattcggtgggcggcaacccgatttatcactggcgctatggcaggcggcgggctcgcca
gataaagcacagtggctacaggcattacaaaacgccccagtagtcagtgatggctctcaa
ccaacaccattagtgctacagcaggaacgtttatatctgcaacgaatgtggcagtacgaa
ggagatgtcgtccaatttattgccagtgactctgtttttataaacagagatagtgatttt
atgaccagtaaaggtattgccacttctgttgatgaatcgctattacgggagacgctagac
gctttgtttggttgtgctggtagtgaggttgattggcaaaaagtggcggcagcggttgcg
gctacccgtagaatttcagttatttccggcgggccgggcacggggaaaaccaccacagta
gccaaacttttgacagcattgatacggcttagccaggggcaacgtttacgtattaaactt
gcggccccaaccggtaaagccgctgcacgccttactgaatcactgggcaaagcgattcgg
caattctttcttactgatgatgaacgtaaattattccctgatcaggcttcgaccttgcac
cgtttactgggtgttcagcccaatagccagcgcctgcgttaccaccgtggtaatccatta
aatcttgatgtactggtcgttgatgaagcatcaatggttgatttacctatgatggcgcgc
ttaattgcggcattacctgccaaggccaaggtgatattccttggtgaccgtgaccaactg
gcctcggttgaggcgggggcggttctgggggatatctgccgttttgccgaattaggttac
agcgagcaacgggcacagcaattaactcagttaacgggctatttattaactaataatgca
ttaaccagcaatgtactaaccaataaggcattagccaataaagcgcagccagatgaaacc
tattctgattcagcgaatgtacgcgatagcctgtgtttactgcgtaaaagttaccgcttc
gatgaaaagtcagggattgggcagcttgctctggccgttaatgcaggggagtatcggcag
gctttatccgtattaaacagtgcgtattctgatgttgaacgcttcccgctggccgatgag
gaagattatcaggtactgctagaggcttgtgctgtggggtatcagcattacctcgaacgg
gtggctgcgttagcccctgcggcagaggtattggcagcatttggccgctaccaactgctg
tgtgcattacgttccgggccattcggtgtcagtggcttaaacgaacgcattgaacaggtt
ttacatcgtaaaggattcattatccgtccatcagggccttctggccgttggtatgttggg
cggccagtgatgatagaacttaatgatagcgcacttggcttattcaacggggatattggt
attgccttacatgataatgaaggcgagctacgggtatattttcaattgcccgatggcaat
ataaagtcagtacaacctagtcgccttcccagccatgaaaccgcttatgctatgacggtt
cataaatcgcagggttcagagtttgaacacacagcattggtattacctaacacgttcatg
cccgtgttaactcgtgaattggtctataccgccattacccgcgcccgtcagcatctgacg
ctttattgcagcgatgccgtgctaagtcatgccatacgtacaccgactctccggctgagt
gggctagttgatcgcttgaatacattaaatcgccaataa

DBGET integrated database retrieval system