KEGG   Yersinia pestis 91001 (biovar Microtus): YP_3087Help
Entry
YP_3087           CDS       T00165                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm00630  Glyoxylate and dicarboxylate metabolism
ypm01100  Metabolic pathways
ypm01110  Biosynthesis of secondary metabolites
ypm01120  Microbial metabolism in diverse environments
ypm01200  Carbon metabolism
Module
ypm_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ypm00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    YP_3087 (aceA)
Enzymes [BR:ypm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     YP_3087 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase ETC_C1_NDUFA4
Motif
Other DBs
NCBI-ProteinID: AAS63257
UniProt: A0A0H2W8B7
Structure
PDB: 

Jmol
Position
complement(3430636..3431943)
Genome map
AA seq 435 aa AA seqDB search
MTISRTQQIQQLEQEWTSPRWKNITRPYSAEDVIKLRGSVNPECTFAQNGAKKLWELLHG
GSRKGYINCLGALTGGQALQQAKAGVEAIYMSGWQVAADANTASSMYPDQSLYPVDSVPA
VVKRINNSFRRADQIQWSNNIEPGSKGYTDYFLPIVADAEAGFGGVLNAFELMKAMIEAG
AAGVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLLIARTDADAAD
LLTSDCDPYDREFITGDRTAEGFFRTRAGIEQAISRGLAYAPYADLVWCETSTPDLALAK
RFADAVHAQFPGKLLAYNCSPSFNWKKNLTDQQIASFQDELSAMGYKYQFITLAGIHSMW
FNMFDLAHAYAQGEGMKHYVEKVQQPEFASVDRGYTFASHQQEVGTGYFDKVTNIIQGGA
SSVTALTGSTEEQQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacgatctctcgtactcaacaaattcagcagttggaacaggaatggacatcgccgcgc
tggaaaaatatcactcggccttatagcgccgaagatgtcatcaagctgcgtggttcggtc
aatccagaatgtacgttcgcacaaaatggtgccaaaaaactgtgggaattgctgcacggc
gggtcgcgtaaagggtatatcaactgtctgggggcattaaccggtggtcaggcgctacaa
caggcgaaagccggtgttgaagccatttatatgtcgggatggcaggtggcggctgatgct
aatacggcatctagcatgtatccagatcagtcactgtatccggtcgactctgtgcctgcg
gtggtgaaacgtatcaacaatagcttccgccgcgctgatcaaattcagtggtcgaataat
attgagccaggtagtaaaggctataccgactatttcctaccgatcgtcgcggatgcggaa
gcgggttttggcggtgtgctgaacgcgtttgaattaatgaaagcgatgattgaagcgggg
gcggcaggggttcattttgaagaccaattggccgcagtgaaaaagtgtgggcatatgggc
ggtaaggtactggtgccgacacaagaggccattcaaaagctggttgctgcccgtttagcc
gcagatgtcttgggtgtaccaacgctgttgattgccaggactgatgcggatgcggctgat
ttattgacctcagattgcgacccctatgaccgggagtttattaccggcgaccgtactgct
gaaggttttttccgcacccgtgccggtattgaacaagcgatcagccgtggcctggcgtat
gccccttatgctgatttggtgtggtgtgaaacctcgacacctgatctggctctggccaaa
cgttttgccgatgctgttcatgctcaattccccggaaaattactggcttataactgttca
ccctcctttaactggaagaagaatctgaccgaccagcaaattgccagcttccaagatgaa
ctctccgccatgggctacaaataccagtttattacgctggcgggtattcatagcatgtgg
ttcaacatgttcgatctggcccatgcgtatgcgcagggtgaaggcatgaaacactacgtt
gagaaagtccagcaacctgagtttgcctctgtggaccgcggctacacctttgcttcccat
cagcaagaagtggggactggctacttcgataaagtcaccaatattattcaggggggcgca
tcatctgtaacggcactgaccggttcgacggaagagcagcagttttag

DBGET integrated database retrieval system