KEGG   Yersinia pestis 91001 (biovar Microtus): YP_3088Help
Entry
YP_3088           CDS       T00165                                 

Gene name
aceB
Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm00620  Pyruvate metabolism
ypm00630  Glyoxylate and dicarboxylate metabolism
ypm01100  Metabolic pathways
ypm01110  Biosynthesis of secondary metabolites
ypm01120  Microbial metabolism in diverse environments
ypm01200  Carbon metabolism
Module
ypm_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ypm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    YP_3088 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    YP_3088 (aceB)
Enzymes [BR:ypm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     YP_3088 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AAS63258
UniProt: A0A0H2W721
Position
complement(3431990..3433588)
Genome map
AA seq 532 aa AA seqDB search
MRQQLAGTELVFTQPFNAAERQVLPDKAIEFLTELVVKFSESRNQLLATRASWQQTIDQG
ALPDFILETNSIRDGDWKIQGIPADLRDRRVEITGPVERKMVINALNANVKVFMADFEDS
LAPSWDKVIDGQINLHDAVKGTISYTNESGKVYQLKPNPAVLIARVRGLHLPEKHVKWQD
EAIPGGLFDFALYFYHNYQQLLAKGSGPYFYLPKMQSYQEAAWWSDVFNFTEQRFGLSQG
TIKATVLIETLPAVFQMDEILYHLRHHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQSV
TMNKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPDKDAEKNKLVLDKVRADKELEASNGH
DGTWVAHPGLADTVMDVFNKVLGSRPNQLEVSREQDKPITAAELLEPCSGERTEAGMRAN
IRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKSLSNGQTVTKELFRS
MLSEEIQVVKLELGAERFDRGRFEEAARLMERITTQDELIDFLTLPGYALLA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgagacaacagttagcgggcacagagttagttttcacccagccttttaatgctgctgag
cggcaggttttaccggataaagccatcgagtttctaaccgaattagtggtgaaatttagc
gaatcgcgtaaccaactccttgccacaagggcatcttggcagcaaaccatcgatcagggg
gcgttacccgattttattttggaaactaattccattcgtgatggtgattggaaaatccaa
ggtattcctgctgacttacgcgatcgtagagttgagatcaccgggccagtagagcggaaa
atggtgatcaatgcgcttaatgccaacgtaaaagtttttatggcggatttcgaagattca
ctggcacccagttgggataaagtgattgatggtcaaattaatctacatgatgcggtgaaa
gggacaatttcctatacgaatgaatcgggcaaggtctatcaattaaaacctaatcccgcg
gtattgattgcacgtgttcgtggcctgcacttaccggaaaaacatgttaaatggcaggac
gaggcgattcccggtggtttattcgatttcgctttgtatttctaccataactatcagcaa
ctgctggcgaagggcagcggcccttatttctatttgccgaagatgcagtcataccaggaa
gccgcttggtggagcgatgtgttcaattttaccgagcagcgctttggtctatcgcagggc
accattaaggcgacggtattaattgagacattacccgccgttttccaaatggatgaaatt
ctctaccacctgcgccaccacattgttggtctgaattgtgggcgctgggactatatcttt
agctatataaaaacattgaaaaaccaccctgaccgcgtgttaccagatcgccagtcagtc
acgatgaataaaccttttcttagcgcgtattcccgtttgttgatcaagacatgccataaa
cgtggcgctttggcgatggggggaatggccgccttcatcccggataaagacgcagaaaag
aataagttggtgttggataaagttcgtgccgacaaagagttagaagccagtaacggccac
gatggaacttgggtggcgcatccgggcttggcagatacggtgatggacgtttttaacaaa
gtattaggttctcggcctaatcaattagaggttagccgcgaacaggataaacctatcacc
gccgctgagttgctggaaccttgttctggcgagcgcactgaagcagggatgcgggccaat
atcagagtcgcggtgcagtacattgaagcatggatatcgggtaatggttgtgtgccgatt
tatggcttgatggaggatgcggctactgcagagatttcccgcacttctatctggcaatgg
atacatcatcagaaaagcctcagtaatggccagacggtgactaaagagctgttccgcagc
atgttgagtgaagaaattcaggttgtgaagcttgagcttggcgcagagcgttttgatcgc
gggcggtttgaagaagctgcacgcttgatggagcgtattacaacacaagacgagcttatc
gacttcctgacgttgccgggctatgcattgcttgcctga

DBGET integrated database retrieval system