KEGG   Yersinia pestis 91001 (biovar Microtus): YP_3088Help
Entry
YP_3088           CDS       T00165                                 

Gene name
aceB
Definition
(RefSeq) malate synthase (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ypm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YP_3088 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    YP_3088 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    YP_3088 (aceB)
Enzymes [BR:ypm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     YP_3088 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3431990..3433621)
Genome map
AA seq 543 aa AA seqDB search
MAAVTLGRGIAMRQQLAGTELVFTQPFNAAERQVLPDKAIEFLTELVVKFSESRNQLLAT
RASWQQTIDQGALPDFILETNSIRDGDWKIQGIPADLRDRRVEITGPVERKMVINALNAN
VKVFMADFEDSLAPSWDKVIDGQINLHDAVKGTISYTNESGKVYQLKPNPAVLIARVRGL
HLPEKHVKWQDEAIPGGLFDFALYFYHNYQQLLAKGSGPYFYLPKMQSYQEAAWWSDVFN
FTEQRFGLSQGTIKATVLIETLPAVFQMDEILYHLRHHIVGLNCGRWDYIFSYIKTLKNH
PDRVLPDRQSVTMNKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPDKDAEKNKLVLDKVR
ADKELEASNGHDGTWVAHPGLADTVMDVFNKVLGSRPNQLEVSREQDKPITAAELLEPCS
GERTEAGMRANIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKSLSN
GQTVTKELFRSMLSEEIQVVKLELGAERFDRGRFEEAARLMERITTQDELIDFLTLPGYA
LLA
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
gtggcagcagtaacattgggaaggggaatagcaatgagacaacagttagcgggcacagag
ttagttttcacccagccttttaatgctgctgagcggcaggttttaccggataaagccatc
gagtttctaaccgaattagtggtgaaatttagcgaatcgcgtaaccaactccttgccaca
agggcatcttggcagcaaaccatcgatcagggggcgttacccgattttattttggaaact
aattccattcgtgatggtgattggaaaatccaaggtattcctgctgacttacgcgatcgt
agagttgagatcaccgggccagtagagcggaaaatggtgatcaatgcgcttaatgccaac
gtaaaagtttttatggcggatttcgaagattcactggcacccagttgggataaagtgatt
gatggtcaaattaatctacatgatgcggtgaaagggacaatttcctatacgaatgaatcg
ggcaaggtctatcaattaaaacctaatcccgcggtattgattgcacgtgttcgtggcctg
cacttaccggaaaaacatgttaaatggcaggacgaggcgattcccggtggtttattcgat
ttcgctttgtatttctaccataactatcagcaactgctggcgaagggcagcggcccttat
ttctatttgccgaagatgcagtcataccaggaagccgcttggtggagcgatgtgttcaat
tttaccgagcagcgctttggtctatcgcagggcaccattaaggcgacggtattaattgag
acattacccgccgttttccaaatggatgaaattctctaccacctgcgccaccacattgtt
ggtctgaattgtgggcgctgggactatatctttagctatataaaaacattgaaaaaccac
cctgaccgcgtgttaccagatcgccagtcagtcacgatgaataaaccttttcttagcgcg
tattcccgtttgttgatcaagacatgccataaacgtggcgctttggcgatggggggaatg
gccgccttcatcccggataaagacgcagaaaagaataagttggtgttggataaagttcgt
gccgacaaagagttagaagccagtaacggccacgatggaacttgggtggcgcatccgggc
ttggcagatacggtgatggacgtttttaacaaagtattaggttctcggcctaatcaatta
gaggttagccgcgaacaggataaacctatcaccgccgctgagttgctggaaccttgttct
ggcgagcgcactgaagcagggatgcgggccaatatcagagtcgcggtgcagtacattgaa
gcatggatatcgggtaatggttgtgtgccgatttatggcttgatggaggatgcggctact
gcagagatttcccgcacttctatctggcaatggatacatcatcagaaaagcctcagtaat
ggccagacggtgactaaagagctgttccgcagcatgttgagtgaagaaattcaggttgtg
aagcttgagcttggcgcagagcgttttgatcgcgggcggtttgaagaagctgcacgcttg
atggagcgtattacaacacaagacgagcttatcgacttcctgacgttgccgggctatgca
ttgcttgcctga

DBGET integrated database retrieval system