KEGG   Yersinia pestis 91001 (biovar Microtus): YP_3400Help
Entry
YP_3400           CDS       T00165                                 

Gene name
xylA
Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YP_3400 (xylA)
   00051 Fructose and mannose metabolism
    YP_3400 (xylA)
Enzymes [BR:ypm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     YP_3400 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3812654..3813973
Genome map
AA seq 439 aa AA seqDB search
MQSYFNELEQVRYEGSQSTNPLAFHHYNPDEMILGKRMADHLRFAACYWHTFCWGGADMF
GANAFDRPWQQPGDALALAKRKAEVAFEFFHKLNVPYYCFHDVDVSPEGASLQEYLNNFA
VMTDVLAEKQAASGVKLLWGTANCFTHPRYGAGAATNPDPEVFSWAATQVFTAMNATRQL
GGENYVLWGGREGYETLLNTDLRQEREQIGRFMQMVVEHKHKTGFQGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHSFHHEIASAIALGIFGSVDANRG
DPQLGWDTDQFPNSVEENTLVMFEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALALKFAAKMIEDGQLDQIVAKRYAGWNSELGQQILQGKMSLEELSRYASQHNLNPQ
HQSGHQELLENKVNRYLFG
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcttattttaatgaattagaacaagtgcgctacgaaggtagccagagcacgaat
cctctggcgtttcatcattacaacccggatgaaatgatccttggtaagcgaatggctgac
catctgcggtttgccgcctgttactggcataccttctgctggggtggggccgatatgttc
ggtgccaatgcttttgatcgcccatggcaacaacctggggatgcactggctctggctaaa
cgcaaagccgaggttgcatttgaattcttccataaactgaatgtaccgtattactgcttc
catgatgtggatgtctcgccagaaggcgcgtcactacaggaatatctgaataacttcgcc
gtaatgaccgatgtactggctgaaaaacaagcagccagtggtgtgaaattattatggggc
acggctaactgctttacccatcctcgttatggtgctggtgccgcgaccaatcctgatcca
gaagtatttagctgggcagccacccaggtctttacggccatgaatgccacccgccaactc
ggcggtgaaaactatgtgttatggggcggacgtgaaggctacgaaacactgttgaatacc
gatttgcgacaagagcgtgaacaaattggccgctttatgcaaatggtcgtcgaacataaa
cacaaaacgggtttccaggggacactccttattgagccaaaaccgcaggagcccactaaa
catcaatacgattatgacgtcgcgacagtttacggcttccttaagcagttcggcttagaa
aaagagattaaagtcaatattgaagccaaccatgccacgctggcggggcactctttccat
cacgaaattgccagtgccatcgccttaggtatttttggctcagtggatgctaaccggggc
gatccgcaactgggctgggataccgatcaattcccaaacagtgtagaagaaaatacactg
gtgatgttcgagatcctcaaagcaggcggttttaccaccgggggcctgaattttgatgcc
aaagtgcgccgccaaagtaccgataaatatgatctgttctacggtcatattggcgcaatg
gacaccatggcactggcgctaaaatttgccgccaaaatgattgaagatgggcaattagat
cagatcgttgccaaacgttatgccggttggaatagcgagctgggccaacagatcctgcaa
ggtaaaatgtcgctggaagagctctcccgctatgccagtcaacataatctgaacccgcag
caccaaagcggtcatcaagagttgttggagaataaggttaaccgctatttatttggttga

DBGET integrated database retrieval system