KEGG   Yersinia pestis 91001 (biovar Microtus): YP_3549Help
Entry
YP_3549           CDS       T00165                                 

Gene name
bgaB
Definition
(GenBank) putative beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
ypm00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ypm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    YP_3549 (bgaB)
Enzymes [BR:ypm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     YP_3549 (bgaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Cellulase DUF4434 Glyco_hydro_14 Glyco_hydro_2_C
Motif
Other DBs
NCBI-ProteinID: AAS63701
UniProt: Q0WII5
Position
complement(4041122..4043182)
Genome map
AA seq 686 aa AA seqDB search
MSKFPPLSAKVSALLHGADYNPEQWENYPDIIDKDIAMMKQAKCNVMSVGIFSWVKLEPS
EGEYNFSWLDELIEKLYAAGIHIFLATPSGARPAWMSQKYPEVLRVGRDRVPALHGGRHN
HCMTSPVYRQKVRQINQKLAERYAHHPAVIGWHISNEYGGECHCHSCQQKFRLWLQDRYQ
TLDNLNEAWWSAFWSHTYSDWSQIESPAPQGEVSIHGLNLDWRRFNTAQVTEFCSEEAKP
LKAANPELPVTTNFMEYFYDYDYWKLAQVIDFISWDSYPMWHREKDETQLACYTAMYHDL
MRTLKQGRPFVLMESTPSATNWQPTSKLKKPGMHILSSLQAVAHGADAVQYFQWRKSRGS
VEKFHGAVVDHVGHIDTRVGREVSELGRILEAMSPVMGSKVDADVAIIFDWESRWAMDDA
EGPRNCGLEYEKTVAEHYRPFWERGIAVDIINADCDLSGYKLVIAPMLYMVREGFAERAT
RFVEQGGQFVATYWSGIVNESDLCHLGGFPGPLRPLLGIWSEEIDCLADGESNQVQGLAG
NKAGLQGPYQAIHLCDLIHLEGATAVARYRDDFYADRAAVTVNFVGEGKAWYVASRNDAA
FQRDFFMNIAEELNLARALDTQFPYGVTAHRRTDGESEFIVVENYSNDSKSLVLPAVYRD
MVDQQPVQGSLTLAPWGSRVLTRYLE
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgtctaagtttccgcccttaagcgcgaaagtttctgcgttattgcatggcgctgactat
aacccagagcaatgggaaaattatcctgacattattgataaagatattgccatgatgaaa
caggcaaaatgcaatgtcatgtcagtgggaatattcagttgggtaaaacttgagccaagt
gaaggagaatataatttctcttggttagatgaattaattgaaaaactttatgctgccggt
atccatatattcctggcgacgccaagtggcgcacgtccggcttggatgtcgcagaaatat
cctgaagttttacgtgtcgggcgtgatcgggtgcctgcgctgcatggtgggcgtcataac
cactgtatgacctcgccggtatatcgccagaaagtgcggcagataaaccagaagttagca
gagcgttacgcccatcatcctgcggttattggctggcacatctctaatgaatacggcggc
gaatgtcactgtcattcctgtcagcaaaaattccgcctctggcttcaggatcgttatcaa
acgctggataaccttaacgaagcctggtggagtgctttctggagccacacctacagcgat
tggtcgcaaattgagtctccagcaccgcaaggtgaagtttcaattcatggtctgaacctt
gactggcggcgttttaataccgctcaggttacggagttttgttctgaagaggctaagcca
ctaaaggcggcaaacccagagttgcctgttacgactaactttatggagtacttctacgat
tacgactactggaagttggcgcaggtgattgattttatctcctgggacagctacccgatg
tggcatcgtgagaaagatgaaacgcagcttgcctgttataccgcgatgtatcatgacctc
atgcgtaccctgaaacagggccgtccatttgtcttaatggaatcaacgccaagcgcgacc
aactggcaacctaccagtaagttgaagaagccggggatgcatatcctctcttctttacag
gctgtcgcgcacggtgcggatgcggtgcagtatttccaatggcgtaagagccgtggctcc
gttgagaagttccacggtgcggttgtcgaccatgttggccacattgatacccgtgttggg
cgggaggtgagcgaactgggtcgtatactcgaggccatgtcgccggtgatgggaagtaaa
gtagacgctgatgttgccatcatttttgattgggaaagtcgttgggctatggacgacgcc
gaaggcccacgtaattgtggcttggaatatgagaaaaccgttgccgagcattaccgtcca
ttctgggaacggggcattgcggtcgatatcattaacgctgactgcgatctgtcgggttac
aagctggtcattgcaccgatgctctatatggttcgcgaagggtttgctgaaagggcgacg
cgttttgtagagcaaggtgggcagtttgtcgcgacctactggagcggtattgtcaacgaa
tctgacctgtgtcatctcggtggcttccctggccctctgcggccgctgttgggtatctgg
tccgaagaaattgactgtctggccgatggcgagagcaatcaagtccaaggacttgcaggc
aataaagccggtctacaggggccttatcaggccatccatctctgcgatttgattcatctt
gaaggggcgacagccgtcgcgcgctatagagatgacttctatgctgaccgtgcggcggtg
accgtaaactttgttggcgaaggtaaagcctggtatgtcgcttcacgtaacgatgcggct
ttccagcgtgatttcttcatgaacattgccgaggagctaaacttggcacgtgcgctagac
acccagttcccttatggggttaccgctcaccgtcgtaccgatggtgagagtgaatttatc
gtggtagaaaactacagtaatgacagcaaatcgctggtgttacctgcggtataccgcgat
atggtcgaccagcagccggtacaaggtagcctgacgcttgccccatggggaagccgagtg
ctaactcgctatctcgaataa

DBGET integrated database retrieval system