KEGG   Yersinia pestis 91001 (biovar Microtus): YP_3926Help
Entry
YP_3926           CDS       T00165                                 

Gene name
rbsK5
Definition
carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ypm  Yersinia pestis 91001 (biovar Microtus)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ypm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    YP_3926 (rbsK5)
Enzymes [BR:ypm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     YP_3926 (rbsK5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4465290..4466222
Genome map
AA seq 310 aa AA seqDB search
MMSVFILGSYAKALVMTTDRIPLAGETLIGYDFRQTWGGKGSDMAVQAVRLGAEVAYAGV
VGDDTFGHEFVGLMQEEGVNIDALTISGELPTGAGLIVKDKEARNVIVVDMGANKLFTPA
LVDSALSQLKQSNVVLTQLEIPLETARYGLQRAKEFGKITILNPAPARDLRGLDLSAIDY
LTPNETEARVALGLPPDDPRSNREIANLLLETGCQYVVMTLGESGSAVFGRNDTQEIPPC
IIDVVDSNGAGDSFNAALAVALDEGLPISEAVLFANATAALCCMDWETVPSYRYREDVDA
FMRSITVKEE
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
gtgatgagtgtatttattctcggcagctatgcgaaagcgctggtgatgaccaccgaccgt
attcctctggctggggaaacgctgattggctatgactttcgccagacgtggggcggtaaa
ggctcggatatggcggttcaggcagtgcgtctgggggcagaggtcgcctatgcgggtgtc
gtcggtgatgacacctttggccatgaatttgtcggcttgatgcaggaagaaggcgtcaat
atcgacgcattaaccatcagcggagaattaccaacgggggcgggacttatcgttaaagat
aaagaagcccgtaacgtgattgtcgtggatatgggggccaataaactgtttaccccagcg
ttggtggacagcgccttatcccagctcaaacaaagcaatgtggtgctcacacagcttgaa
attccgctggaaacggcacgttacggactccaacgggcaaaagaattcggcaaaataacc
atcctgaacccggctccggcaagggatctgcgcggtctcgatctcagcgcgattgattat
ttgacccctaatgaaacggaagcccgcgtggctctgggtctgcctccggatgacccacgc
agcaaccgagagattgccaacctcttactggaaaccggttgccaatatgtcgtgatgacg
ctgggtgaatcaggttctgcggtatttggtcgcaacgacacacaagaaatccccccctgc
atcattgatgtcgtcgacagtaacggtgcaggtgacagctttaacgcggcactggccgtc
gcgctggatgaagggctgccgattagcgaagctgtgctgtttgctaacgccacggcggcg
ttgtgctgtatggattgggaaacggttccgtcctatcgctaccgcgaagatgtcgatgct
tttatgcgatctataaccgtgaaagaggaataa

DBGET integrated database retrieval system