KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_0015Help
Entry
YPN_0015          CDS       T00370                                 

Definition
(RefSeq) isocitrate lyase
  KO
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ypn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YPN_0015
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    YPN_0015
Enzymes [BR:ypn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     YPN_0015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Structure
PDB: 

Jmol
Position
21383..22690
Genome map
AA seq 435 aa AA seqDB search
MTISRTQQIQQLEQEWTSPRWKNITRPYSAEDVIKLRGSVNPECTFAQNGAKKLWELLHG
GSRKGYINCLGALTGGQALQQAKAGVEAIYMSGWQVAADANTASSMYPDQSLYPVDSVPA
VVKRINNSFRRADQIQWSNNIEPGSKGYTDYFLPIVADAEAGFGGVLNAFELMKAMIEAG
AAGVHFEDQLAAVKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLLIARTDADAAD
LLTSDCDPYDREFITGDRTAEGFFRTRAGIEQAISRGLAYAPYADLVWCETSTPDLALAK
RFADAVHAQFPGKLLAYNCSPSFNWKKNLTDQQIASFQDELSAMGYKYQFITLAGIHSMW
FNMFDLAHAYAQGEGMKHYVEKVQQPEFASVDRGYTFASHQQEVGTGYFDKVTNIIQGGA
SSVTALTGSTEEQQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgacgatctctcgtactcaacaaattcagcagttggaacaggaatggacatcgccgcgc
tggaaaaatatcactcggccttatagcgccgaagatgtcatcaagctgcgtggttcggtc
aatccagaatgtacgttcgcacaaaatggtgccaaaaaactgtgggaattgctgcacggc
gggtcgcgtaaagggtatatcaactgtctgggggcattaaccggtggtcaggcgctacaa
caggcgaaagccggtgttgaagccatttatatgtcgggatggcaggtggcggctgatgct
aatacggcatctagcatgtatccagatcagtcactgtatccggtcgactctgtgcctgcg
gtggtgaaacgtatcaacaatagcttccgccgcgctgatcaaattcagtggtcgaataat
attgagccaggtagtaaaggctataccgactatttcctaccgatcgtcgcggatgcggaa
gcgggttttggcggtgtgctgaacgcgtttgaattaatgaaagcgatgattgaagcgggg
gcggcaggggttcattttgaagaccaattggccgcagtgaaaaagtgtgggcatatgggc
ggtaaggtactggtgccgacacaagaggccattcaaaagctggttgctgcccgtttagcc
gcagatgtcttgggtgtaccaacgctgttgattgccaggactgatgcggatgcggctgat
ttattgacctcagattgcgacccctatgaccgggagtttattaccggcgaccgtactgct
gaaggttttttccgcacccgtgccggtattgaacaagcgatcagccgtggcctggcgtat
gccccttatgctgatttggtgtggtgtgaaacctcgacacctgatctggctctggccaaa
cgttttgccgatgctgttcatgctcaattccccggaaaattactggcttataactgttca
ccctcctttaactggaagaagaatctgaccgaccagcaaattgccagcttccaagatgaa
ctctccgccatgggctacaaataccagtttattacgctggcgggtattcatagcatgtgg
ttcaacatgttcgatctggcccatgcgtatgcgcagggtgaaggcatgaaacactacgtt
gagaaagtccagcaacctgagtttgcctctgtggaccgcggctacacctttgcttcccat
cagcaagaagtggggactggctacttcgataaagtcaccaatattattcaggggggcgca
tcatctgtaacggcactgaccggttcgacggaagagcagcagttttag

DBGET integrated database retrieval system