KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_0198Help
Entry
YPN_0198          CDS       T00370                                 

Definition
(GenBank) short chain enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
ypn00071  Fatty acid degradation
ypn00280  Valine, leucine and isoleucine degradation
ypn00281  Geraniol degradation
ypn00310  Lysine degradation
ypn00362  Benzoate degradation
ypn00380  Tryptophan metabolism
ypn00410  beta-Alanine metabolism
ypn00640  Propanoate metabolism
ypn00650  Butanoate metabolism
ypn00903  Limonene and pinene degradation
ypn00930  Caprolactam degradation
ypn01040  Biosynthesis of unsaturated fatty acids
ypn01100  Metabolic pathways
ypn01110  Biosynthesis of secondary metabolites
ypn01120  Microbial metabolism in diverse environments
ypn01130  Biosynthesis of antibiotics
ypn01200  Carbon metabolism
ypn01212  Fatty acid metabolism
Module
ypn_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ypn00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    YPN_0198
   00650 Butanoate metabolism
    YPN_0198
  Lipid metabolism
   00071 Fatty acid degradation
    YPN_0198
   01040 Biosynthesis of unsaturated fatty acids
    YPN_0198
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YPN_0198
   00310 Lysine degradation
    YPN_0198
   00380 Tryptophan metabolism
    YPN_0198
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YPN_0198
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    YPN_0198
   00281 Geraniol degradation
    YPN_0198
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    YPN_0198
   00930 Caprolactam degradation
    YPN_0198
Enzymes [BR:ypn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     YPN_0198
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     YPN_0198
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     YPN_0198
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     YPN_0198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ABG16531
JGI: YPN0198
UniProt: Q1CN99
Position
complement(242685..244874)
Genome map
AA seq 729 aa AA seqDB search
MLYQSETLQLHWLENGIAELVFDAPGSVNKLDTKTVANLGEALNVLEKQSELKGLLLRSA
KTALIVGADITEFLSLFNAPPEKLHQWLVFANTIFNRLEDLPVPTISAINGYALGGGCEC
ILATDFRIASPEARIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIATGKDVTANDALK
IGLVDAVVDPEKLVGSALTMLKQAIDGKLDWQAARRPKLEPLKLNPTEAAMCFTIAKGRV
MQVAGKHYPAPLTAVKTIEAAAKFGRTEALNLETNSFVPLAGSNEARALVGIFLNDQYVK
AQAKKLSKGVAAPKLAAVLGAGIMGGGIAYQSALKSVPVIMKDINENSLDLGMNEAAKLL
NKQLERGKVDGLKMASILATIRPTLDYAGIERAQVIVEAVVENPKVKAAVLAEVEALIGE
DTVLASNTSTIPIDQLAKSLKRPENFCGMHFFNPVHRMPLVEIIRGAKTSDKTLAAVVAY
ATQMGKTPIVVNDCPGFFVNRVLFPYLAGFGMLVRDGGDFHQIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPERMNKDYRDAVDVMFDNQRFGQKNGQGFYRYTQDAKGKP
RKENDEQVDKLLAEISQPLQEFSDEDIIARTMIPMINEVVRCLEEGIIASAAEGDMALVY
GLGFPPFHGGVFRYLDTLGSANYVEMAQRYAHLGALYHVPAGLRAKAEHNESYYPVAAAL
LDVSTNQPA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctaccaaagcgaaacattacagcttcactggttggaaaacggtattgccgagttg
gtatttgatgctccgggttcagttaataaactggatactaaaaccgtagccaatttgggt
gaagccttgaatgtgttagaaaaacaaagtgaactcaaagggttgctattacgttcagcg
aagacagccttgattgttggtgccgatattactgagtttctatccctgtttaatgcccca
ccagaaaaactgcaccagtggctggtgttcgccaacaccattttcaatcgactggaagat
ttacccgtgccaaccatttcagcaattaatggatacgcactaggtggaggatgtgaatgt
attttggcgacggatttccgtatcgcctccccagaagcacgtatcggcctcccagaaacc
aagttgggcatcatgccgggcttcggtggttcggtccgtttaccacgcctgctaggcgct
gatagtgcacttgagattattgccacaggtaaagatgttactgccaacgatgcactaaag
attgggctggttgatgcagttgtcgaccctgagaaactggtcggttcagccttaactatg
ctgaaacaagctattgacggtaagctcgattggcaggcagcacgccgcccaaaactggaa
cccctaaaacttaatcctaccgaagcggctatgtgttttaccattgctaaaggcagagtc
atgcaagtcgccgggaaacactatcccgcaccattgactgcagtaaaaactattgaagcc
gccgcaaaatttggtcgtaccgaagcgctgaacttggaaaccaacagttttgtcccttta
gcgggttccaatgaagctcgcgctttggtggggatttttcttaacgaccagtatgtaaaa
gcgcaagccaaaaaactgtccaaaggcgtcgctgcaccaaaactggctgcggttctgggc
gcagggatcatgggaggtggaattgcctatcagtcagcgctgaaaagtgtgccagtcatt
atgaaagatattaatgaaaactcgctggatcttggaatgaatgaggccgctaaattactg
aataaacagctggaacgcggcaaagtggatggccttaaaatggcaagtattctagcgact
attcgaccaaccttggattatgcaggtattgaacgagcccaagtgatcgtcgaagctgtg
gtggagaacccgaaggttaaagccgctgtacttgcggaagtagaagcattaatcggtgaa
gataccgttttagcttccaatacctcgacgattcctattgatcagttggctaaatcactc
aaacgccctgaaaatttctgcggtatgcacttcttcaatccagtacaccggatgccactg
gttgaaattattcgtggggcaaaaacctcagataaaacccttgcggcagtagtcgcttac
gctacacaaatggggaaaaccccaattgttgtcaatgattgccctggtttcttcgttaac
cgcgtcttattcccgtatctcgcaggctttggcatgttagtcagagacggtggggatttc
caccaaattgataaagtgatggaaaaacagtttggctggccgatggggcccgcttatcta
ttagatgtcgtcggtattgatactgcccatcatgcacaagcggtgatggctgccggtttc
cctgagcgaatgaacaaggattaccgtgatgcggttgatgtgatgtttgataaccaacga
tttgggcaaaagaatggtcaggggttttaccgctatacgcaagatgcaaagggtaagcca
cgtaaagaaaatgacgaacaagtggataaattactggcagaaatcagccaacctctccaa
gaattcagcgatgaagacattattgcccgcaccatgatcccaatgatcaatgaagtcgtc
cgctgcctggaagaaggtattattgccagcgcagccgagggtgacatggcgctggtttat
ggccttggcttccctccattccacggaggagtcttccgttaccttgatacgctcggtagc
gcaaattatgtcgaaatggctcaacgctatgcccaccttggtgcgttatatcacgttcct
gcggggctacgagctaaagctgaacataacgaaagttattatcctgtggcagcagcgctg
cttgatgtttctaccaatcaaccagcatga

DBGET integrated database retrieval system