KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_0299Help
Entry
YPN_0299          CDS       T00370                                 

Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:ypn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    YPN_0299
   00240 Pyrimidine metabolism
    YPN_0299
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    YPN_0299
   03430 Mismatch repair
    YPN_0299
   03440 Homologous recombination
    YPN_0299
Enzymes [BR:ypn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     YPN_0299
DNA replication proteins [BR:ypn03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     YPN_0299
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
368062..368499
Genome map
AA seq 145 aa AA seqDB search
MASRRDLLLQQLGITQWVLRRPAVLQGEIAIHLPEDTRLLIVAQQLPEHGDPLLCDVLRS
LGLTPHQVYALTPDQVAMLPEDTQCNSWRLGISEPLAVAGAQLHSPELAGLYQDAGAKRA
LWQQICHYEADFYPDASRSGHSIPN
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaagacgagacttgctgttacagcagcttggcattacgcagtgggtattgcgc
cgtcctgccgtcttgcagggtgagattgcaatacatttacctgaagatacccgcctactg
attgtggcacagcaactgcctgaacacggtgatccactgttgtgcgatgtgctacgcagt
ttgggcctaaccccccatcaggtttatgccttgacgccggatcaggtcgcgatgttgccg
gaagatacgcagtgcaacagttggcgattgggcatcagtgagccgcttgcggtggccggt
gcacaattacatagcccagaattagctgggctttatcaagatgcgggcgctaagcgcgca
ctttggcagcagatttgtcattatgaagcagatttctatcctgacgccagccgatctggc
cacagcataccaaattga

DBGET integrated database retrieval system