KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_0309Help
Entry
YPN_0309          CDS       T00370                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    YPN_0309
Enzymes [BR:ypn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     YPN_0309
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
377848..378720
Genome map
AA seq 290 aa AA seqDB search
MAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAF
MPTYSLSADLAQAIVGVANGAGCKTTALLTDMNQVLASSAGNGVEVREAVRFLTGEYRNP
RLLEVTMALCVEMLLSGGLAHDEADARAKLQAVLDNGKAAEVFGRMVAAQKGPADFVERY
DSYLPVATLSKPVFAEQTGIITAMDTRALGMAVVALGGGRRRATDPIDYSVGLTEMARLG
TRVDGQQPLAVIHANNEDDWQQAAEVVRAAITLGNNTPEETPVIYRRITE
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtggcgattatcggccaaaccagctcgctggcccctgccgataagcgtttttacgcgacc
cgcgatattacggcaacagtcgattctattccattgattacggcctctattctggccaaa
aaattggcggaagggctggatgcattggtcatggacgtgaaggtcggctccggtgccttt
atgccaacctactcgttgtcggctgatttggcgcaggcgattgttggtgtggcaaacggt
gcgggttgcaaaaccacggcgctactgacggacatgaaccaagtcctggcgtccagcgcc
ggtaatggggtcgaagtccgcgaagctgtgcgtttcctgacgggcgaatatcgcaaccca
cgtttgctggaagtgactatggcgctgtgtgttgaaatgttgctgtcaggcggtttagcg
cacgatgaagccgatgcccgtgccaagctgcaagccgttttggataatggcaaagcggcg
gaagtctttggccgtatggtggccgcgcaaaaaggcccggcagactttgttgaacgctat
gacagctacctgcccgttgctaccctaagcaaaccggtatttgctgaacagacgggaatc
attactgcaatggatacccgcgccttgggtatggcggtggtcgccctcggcgggggacgc
cgtcgggcaacggatcccattgattatagtgtagggctgacggagatggcccgtttgggt
acccgtgttgatgggcagcagccgcttgcggtgatccatgccaataacgaagatgactgg
cagcaggcggcagaggttgtgcgtgcggccatcaccttagggaataacacgccagaagaa
acgccagtgatttatcgccgtatcactgaataa

DBGET integrated database retrieval system