KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_0359Help
Entry
YPN_0359          CDS       T00370                                 

Gene name
folA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ypn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    YPN_0359 (folA)
   00670 One carbon pool by folate
    YPN_0359 (folA)
Enzymes [BR:ypn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     YPN_0359 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
438302..438784
Genome map
AA seq 160 aa AA seqDB search
MIISLIAALAADRVIGMENAMPWHLPADLAWFKRNTLNKPVIMGRKTFESIGRPLPGRLN
IVISSQPGTDERVTWAASIEEALAFAGNAEEVMVMGGGRVYKQFLDRANRMYLTHIDAEV
GGDTHFPDYEPDEWESVFSEFHDADEANSHSYCFEILERR
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgattatcagcctgatcgctgcattggcagcagatcgcgttattggcatggaaaacgct
atgccatggcatttaccggctgatttagcgtggttcaaacgtaacacgttaaataaaccg
gtaattatgggtcgtaagaccttcgaatctatcggtcgcccccttccgggaagactgaat
attgtcatcagtagccagcctggtactgatgaacgtgtgacgtgggcggcctcgattgaa
gaagcattggcgtttgctggcaatgcggaagaagtgatggtcatgggcggtggccgtgtc
tataagcaattcttagaccgcgcaaatcgcatgtatctcacgcatattgatgcggaggtc
ggtggcgatactcacttccctgattatgagccagatgaatgggaaagcgtattcagtgag
tttcatgatgccgatgaagctaactcacacagttattgcttcgaaattctagagcgccgc
taa

DBGET integrated database retrieval system