KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_0416Help
Entry
YPN_0416          CDS       T00370                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:ypn00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ypn00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
510923..512410
Genome map
AA seq 495 aa AA seqDB search
MADRNLRDLFAPWGLDVPERALREMTLDSRIAAAGDLFVAVVGHQTDGRRYIPQAIAQGV
AAIVAEADGVAPDVSVAEIHGVPVIYLRNLNQHLSTLAGQFYHQPGAALRLVGVTGTNGK
TTTTQLLAQWSQALGETSAVMGTVGNGLLGQVIPTENTTGSAVDIQHLLRNLVDQGATFA
AMEVSSHGLIQDRVAALSFAAVVFTNLSRDHLDYHGNMTSYEAAKWLLFSTHQSEHKIIN
ADDDVGRRWLSQLPQAVAVSMAGNVPKGWNGPWLSANKVIYHDNGASIAFDSSWGEGELE
SRLMGAFNVSNLLVALATLLVQGYPMAQLLAAAPHLQPVCGRMEVFNAPGKPTVVVDYAH
TPDALEKALAAARLHCTGKLWCVFGCGGDRDKGKRPLMGGIAEQLADCVVVTDDNPRSEE
PQAIVADILSGLLDAGRVQAIHGRAEAVTSAIMQAKEDDVVLIAGKGHEDYQLVGNRRLD
YSDRVTVARLLGGQA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatcgtaatttgcgcgacttattcgctccttgggggctagacgtcccggagcgg
gcgctacgggaaatgacattagacagccgtattgcagctgccggcgatttatttgttgcg
gttgttggccaccagacggatgggcgtcgctacatcccgcaagctatcgcccagggtgtg
gctgcaattgtggccgaagccgatggtgtcgcaccggatgtcagcgttgccgagatacat
ggcgtccctgttatttatttgcgtaatttgaatcagcacttatccacgctggctgggcag
ttttaccatcagcctggcgccgcattgcgtttggtcggtgtaaccggaacgaatggcaaa
accaccactacgcaattgttagcacaatggagccaggcgctgggcgaaaccagtgcagtc
atgggcaccgtaggtaatggtttattagggcaggtgatacccacggagaacaccaccggt
tctgccgtagatattcaacatttgctgcgtaatctggttgatcaaggtgcgacttttgcc
gccatggaagtttcttcccacggtttgattcaagaccgtgttgctgcgttatcctttgca
gccgtagtgttcactaacttaagccgcgatcatctggattatcacggcaatatgacgagc
tatgaggcggccaaatggctgctgttctccactcatcagtccgaacacaaaattatcaat
gctgatgatgacgttggccgccgttggttaagccaattgccgcaggctgtcgccgtcagc
atggcaggcaatgtccccaaaggctggaatggcccgtggttatctgccaacaaggtgatt
tatcacgataatggtgccagcatcgcgtttgattcaagctggggcgaaggcgagctagaa
agccgtctgatgggcgctttcaacgtcagtaacttgttggtggcattagcgacgttactg
gttcaggggtatcccatggcgcagttgttagctgcagcgcctcatctgcaaccggtttgt
gggcgtatggaagtgtttaatgcgccgggtaaaccaaccgttgtggtggattatgcccac
acgccagatgcattagaaaaagccttggccgccgcccgtttacattgcaccggcaagctg
tggtgtgtgtttggctgtggcggtgaccgtgataaaggtaagcgcccacttatgggcggt
atcgcagaacaactggctgactgtgtcgtggtgaccgatgataacccacgcagtgaagag
ccacaggcgattgttgctgacattctcagtggcttgctggacgcggggcgtgtgcaggcg
atacatggccgtgccgaagccgtaaccagtgccattatgcaagccaaagaagacgacgtt
gtcctgattgccggtaaaggccatgaagattatcaattagttggcaatcgtcgcttggat
tattcagaccgtgtcaccgtcgcgcgtttgttaggggggcaggcatga

DBGET integrated database retrieval system