KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_0736Help
Entry
YPN_0736          CDS       T00370                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Brite
Enzymes [BR:ypn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     YPN_0736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_31 Methyltransf_25 Methyltransf_23 Methyltransf_11 CMAS GCD14 DREV
Motif
Other DBs
NCBI-ProteinID: ABG17068
JGI: YPN0736
UniProt: Q1CLR2
Position
860528..861154
Genome map
AA seq 208 aa AA seqDB search
MVNKRMQTLLMQLRQQGIHDERLLQAIEAVPRERFVDEALAHKAYENTALPIGAGQTISQ
PYMVARMTELLQLTPTSRVLEIGTGSGYQTAILAHLVDHVCSVERIKGLQWQAKRRLKQL
DLHNVSTRHGDGWLGWQSRGPFDAIIVTAAPPEIPDALLEQLDEGGILVLPVGEQFQTLK
YVQRRNNEYHIETVEAVRFVPLVKGELA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggtaaataaacgcatgcaaacattgttgatgcagttacgtcagcaaggtattcacgat
gaacgcctgttacaggcgatcgaagcggtaccgcgtgagcgttttgtcgatgaagcgttg
gctcataaggcttatgagaataccgctctccctataggtgcggggcaaacgatttctcag
ccttatatggtggcgcgaatgacagagttactgcaattgacgccaacgtccagagtctta
gagatcggaacggggtcaggctaccagacggctattttggcgcatctggtcgatcatgtc
tgttcagtcgagcgaatcaaagggttacagtggcaggcaaaacgtcgcctaaaacagttg
gatctgcataatgtgtcgacccgccatggtgatggttggttgggctggcagtctcgtggg
ccgtttgatgccattattgtaaccgcagcaccgcctgaaattccggatgcattacttgag
caattggatgaagggggaatactggttcttcccgttggtgagcagttccaaacattaaag
tacgtgcaacgccgtaacaatgaataccatattgagacggtggaagccgtccgttttgtt
cctctggttaaaggggaacttgcctaa

DBGET integrated database retrieval system