KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_0781Help
Entry
YPN_0781          CDS       T00370                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypn00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    YPN_0781
Enzymes [BR:ypn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     YPN_0781
Exosome [BR:ypn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YPN_0781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
912698..914185
Genome map
AA seq 495 aa AA seqDB search
MSTPIILAIDEGTTNAKAIAVDRAGRVLAKASVPLQLEHPQPGWAEQDPLAIWLAVSQAV
EGCLNQLAGAQVAGIAISNQRESVLIWERETGTPLTPVVSWQCRRSEAFCLALRQLPAAA
MVAERTGLQIDPLFPAAKIHGMLAQIPHGAERAAHGELCVGTLDCWLTWQFSEGQSFSTD
FSNAARTQLFNIHSGQWDPDLLALFGIPSLCLPAVLPSASIHGHTARTGILGLEQGVPIV
AHIGDSHAALYGQGGDQAGEIKATYGTGSSLMMTLKQASAPSHGLSTTIAWHDGELRYAL
EGNITHTGSGVAWVSRMLGISDLSRLTDMAESQSGNQGVYFVPALSGLGAPYWDSQARGL
FCGLTDATTPAVLARAALESVAYQIADVFFAMENAAHHRLERLRVDGGATSNRWLMQFQA
DLLQRTLIRNHTAEVSALGAAYLGGKTLGWWQDSQQLAALPREVEYIEPRIHSAEMQDNY
SLWQTAIARARFQPK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgccaatcattctggctattgatgaagggacaaccaacgccaaagccattgcg
gtagatcgtgccgggcgagttctggcgaaagcctcggtaccattacaactggagcatcct
cagcccggttgggcagaacaggatccgctggcgatttggctggcggtttctcaggcggtt
gaggggtgcctaaatcaattggcgggcgcacaggtggcggggattgccatcagtaatcag
cgtgaatcggtactgatttgggaacgggaaaccggcacgccgctcacgccagtcgtaagc
tggcagtgccgtcgttcagaggctttctgtctggctttgcgccaattaccggctgcggcg
atggttgcggaacggactggattgcagattgatcccctgtttcctgcggctaaaattcat
ggcatgttggcgcagatccctcatggcgctgaacgtgccgctcacggtgagctgtgtgtt
ggcacgcttgattgctggctgacctggcagtttagcgaagggcaaagtttctcgactgac
ttctctaatgcggcccggacccagctgtttaatatccattcaggtcaatgggaccccgat
ttactggcgctgtttggtatcccaagtctttgcctgcccgccgtcttaccctcggcatcc
atccacggacacaccgcgcgcaccgggattctcggcctggagcagggcgtgcctatcgtg
gcacacattggtgattcgcacgccgcgctgtacgggcaaggcggcgaccaggccggtgaa
atcaaagccacttatggcaccggctcctctctgatgatgacgctaaaacaggccagtgca
ccaagccacggcctaagcaccaccattgcctggcatgacggcgaattacgttatgccctt
gaaggtaacatcacccataccggctcaggagtggcatgggtctcgcgcatgttagggatc
agtgatttgtcacgtctgactgacatggcagaaagccaatcaggtaatcaaggcgtctat
tttgtaccggcattatcaggactgggtgcgccttattgggacagtcaggcgcgtggtttg
ttctgtggtctgacggatgccacgacaccggccgtactggcgcgagcggcacttgaatca
gtcgcttatcaaatagccgatgttttctttgcgatggagaatgcggctcatcatcgcctt
gaacggctgcgggttgatggcggcgcgaccagtaatcgctggctgatgcagtttcaggcc
gatttattgcagcgcacattgatacgtaatcacacggcagaagtgtcagcactgggtgcc
gcgtatttgggcgggaaaacccttggctggtggcaggatagccaacaactggctgcgctc
ccccgtgaagtggaatacatcgaaccgcgcattcacagtgcggagatgcaagataactat
agcctctggcaaacggccatcgcgcgtgcgcgttttcagccgaaataa

DBGET integrated database retrieval system