KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_0871Help
Entry
YPN_0871          CDS       T00370                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ypn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YPN_0871
  Amino acid metabolism
   00330 Arginine and proline metabolism
    YPN_0871
Enzymes [BR:ypn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     YPN_0871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1018655..1019758
Genome map
AA seq 367 aa AA seqDB search
MSGSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQQHAKGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHIGQMLLTRADLEDRERFLNARDT
MNALLDNRIVPVINENDAVATAEIKVGDNDNLSALAAILASADKLLLLTDQAGLYTADPR
NNPEAELIREVHGIDDVLRGMAGDSVSGLGTGGMATKLQAADVACRAGIDVVIAAGSQVG
VIADVIDGTPVGTRFHSLETPLENRKRWIFGAPPAGEITVDDGAVFAIMERGSSLLPKGI
RSVKGDFSRGEVIRIRNLNGRDLAHGVSRYNSDALRMLAGHHSQQISEILGYEYGPVAVH
RDDMIVS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcagccagacattggttgtgaaattggggacgagtgtactgaccgggggttcc
cgccgtcttaaccgtgcccatattgttgaattggtgcgtcaatgtgcccagcaacacgca
aaaggtcatcgtattgttattgtcacctctggggcgattgctgcgggtcgtgaacattta
gggtatccagagttgcccgccactattgcctcgaaacaattgctagccgcggttgggcaa
agccggttaattcagctctgggaacaactgttttcaatttatggcattcatatcggccag
atgctgctaacccgcgcagatttagaggatcgtgagcgttttcttaatgcccgcgatacc
atgaatgcgttgcttgataaccgcattgtaccggtgatcaatgagaacgacgccgtcgct
actgctgaaatcaaagtgggcgataacgataatctctccgcattggcggccattttggcc
agtgcagataagctactgttgttgaccgatcaggcggggttgtacaccgctgatccgcgt
aacaatccagaagcggagttaattcgcgaagtgcatggcattgatgatgtcctgcgcggg
atggccggagacagcgtttcggggctcgggacggggggcatggcgactaaactgcaagcg
gcggatgtcgcgtgccgtgcgggtattgatgtggtgattgccgcaggtagccaggtgggt
gtgattgccgatgtgattgacggtacgccagtcggtacccgtttccactcattggaaaca
ccattagaaaaccgtaaacgttggatttttggtgcgccaccggcaggtgaaatcacagtg
gacgacggtgctgtatttgcgatcatggaacggggcagttcgctgctgccaaaaggcatt
cgcagcgttaaaggggacttctcccgtggtgaagtgatccgtatccgtaatctcaatggg
cgggatttagcacacggtgtttcacgctataacagtgatgcattgcgcatgttagcgggg
catcactcgcaacaaatcagtgaaatcctcggatatgaatacggcccggtggctgttcat
cgtgatgatatgattgtcagctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system