KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_0871Help
Entry
YPN_0871          CDS       T00370                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
ypn00330  Arginine and proline metabolism
ypn00332  Carbapenem biosynthesis
ypn01100  Metabolic pathways
ypn01130  Biosynthesis of antibiotics
ypn01230  Biosynthesis of amino acids
Module
ypn_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ypn00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    YPN_0871
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    YPN_0871
Enzymes [BR:ypn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     YPN_0871
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ABG17203
JGI: YPN0871
UniProt: Q1CLC7
Position
1018655..1019758
Genome map
AA seq 367 aa AA seqDB search
MSGSQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQQHAKGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHIGQMLLTRADLEDRERFLNARDT
MNALLDNRIVPVINENDAVATAEIKVGDNDNLSALAAILASADKLLLLTDQAGLYTADPR
NNPEAELIREVHGIDDVLRGMAGDSVSGLGTGGMATKLQAADVACRAGIDVVIAAGSQVG
VIADVIDGTPVGTRFHSLETPLENRKRWIFGAPPAGEITVDDGAVFAIMERGSSLLPKGI
RSVKGDFSRGEVIRIRNLNGRDLAHGVSRYNSDALRMLAGHHSQQISEILGYEYGPVAVH
RDDMIVS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcagccagacattggttgtgaaattggggacgagtgtactgaccgggggttcc
cgccgtcttaaccgtgcccatattgttgaattggtgcgtcaatgtgcccagcaacacgca
aaaggtcatcgtattgttattgtcacctctggggcgattgctgcgggtcgtgaacattta
gggtatccagagttgcccgccactattgcctcgaaacaattgctagccgcggttgggcaa
agccggttaattcagctctgggaacaactgttttcaatttatggcattcatatcggccag
atgctgctaacccgcgcagatttagaggatcgtgagcgttttcttaatgcccgcgatacc
atgaatgcgttgcttgataaccgcattgtaccggtgatcaatgagaacgacgccgtcgct
actgctgaaatcaaagtgggcgataacgataatctctccgcattggcggccattttggcc
agtgcagataagctactgttgttgaccgatcaggcggggttgtacaccgctgatccgcgt
aacaatccagaagcggagttaattcgcgaagtgcatggcattgatgatgtcctgcgcggg
atggccggagacagcgtttcggggctcgggacggggggcatggcgactaaactgcaagcg
gcggatgtcgcgtgccgtgcgggtattgatgtggtgattgccgcaggtagccaggtgggt
gtgattgccgatgtgattgacggtacgccagtcggtacccgtttccactcattggaaaca
ccattagaaaaccgtaaacgttggatttttggtgcgccaccggcaggtgaaatcacagtg
gacgacggtgctgtatttgcgatcatggaacggggcagttcgctgctgccaaaaggcatt
cgcagcgttaaaggggacttctcccgtggtgaagtgatccgtatccgtaatctcaatggg
cgggatttagcacacggtgtttcacgctataacagtgatgcattgcgcatgttagcgggg
catcactcgcaacaaatcagtgaaatcctcggatatgaatacggcccggtggctgttcat
cgtgatgatatgattgtcagctaa

DBGET integrated database retrieval system