KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_0968Help
Entry
YPN_0968          CDS       T00370                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ypn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1125057..1125662
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLESLMEALRCLPGVGPKSAQRMAFQLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQEHCTICLNPRRQQNGQICVVESPADIHAIEQTGQFGGRYFVLMGHLSPMDGIGP
GDIGLDLLEKRLSTEAISEVILATNPTVEGDATANYIGQMCGQYGILASRIAHGVPVGGE
LEMVDGTTLSHSLAGRNPIKY
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagtccactcctggagtcattaatggaggcgttgcgttgtttaccgggtgtt
ggcccgaaatcggcgcaacgtatggcatttcagctattacagcgcgatcgtagtggtgga
atgcgcctggcgcaggctctgacacgggcaatgtctgaaataggccattgtgcagattgt
cgtacatttaccgagcaagagcactgcaccatctgcttgaatccccgccgtcaacaaaat
ggtcaaatctgtgtggtcgaaagcccggcagatatccatgccattgagcaaactggccag
tttggcgggcgttattttgtgctgatggggcatttatcacctatggatggtattggccct
ggtgatatagggctagatctactggagaaacggctttctactgaggctatcagtgaggtc
attttagccacgaatccaaccgttgaaggggatgcaacagccaactatatcggccagatg
tgtggccaatatggcatactggccagccgcatcgcccatggcgttcctgttggtggcgag
ttagaaatggttgatggcaccacgttatctcactcgttagcagggcgtaatcccatcaag
tactga

DBGET integrated database retrieval system