KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_1009Help
Entry
YPN_1009          CDS       T00370                                 

Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1 (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:ypn00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    YPN_1009
Enzymes [BR:ypn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     YPN_1009
   3.1.2  Thioester hydrolases
    3.1.2.-  
     YPN_1009
Lipid biosynthesis proteins [BR:ypn01004]
 Fatty acid synthase
  Component type
   YPN_1009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1167854..1168492)
Genome map
AA seq 212 aa AA seqDB search
MMNFKNVFRWHLPFLLLLGLFSLRAAATDTLLILGDSLSAGYRLPIAQAWPSLLDKKWQA
TPSLPKVVNASISGDTAAQGLARLPALLKQHQPRWVLIELGANDALRGFPTQDIQRDLSE
IINQITAAKAQPLLMQIRIPPNYGRRYTDAFTAIYPQLAQQFDIPLLPFFMEQVAVKPEW
MQDDGLHPNGDAQPFIADWMAQQLKPLVVDPK
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacttcaagaacgttttccgctggcatcttcccttccttttactgttgggatta
ttcagtttgcgtgccgccgcaaccgatacactattgattctcggcgacagtttaagcgcc
ggttaccgcctgcctattgcacaggcatggccttcgctattggataaaaaatggcaagcc
acgccttcattaccgaaggtggtcaatgccagtatcagtggagataccgccgcgcaaggg
ctagcgcgcttacccgctctactcaaacaacatcagccacgctgggtgctgattgaactg
ggcgccaatgacgcgctgcgcgggtttccgacgcaggacattcaacgggatctgagcgaa
attatcaatcagataaccgcagcgaaagcccagccattattgatgcaaatccgtattccc
cctaactatggccgccgttatactgatgctttcaccgctatctatccacaactggcgcaa
cagttcgacatccccctactccctttttttatggaacaggttgccgttaagccagagtgg
atgcaggatgatggtttacaccctaacggcgatgcccaaccgtttatcgcggattggatg
gcgcaacaactcaagccgttagttgttgatccgaaataa

DBGET integrated database retrieval system