KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_1332Help
Entry
YPN_1332          CDS       T00370                                 

Definition
(GenBank) succinyldiaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
ypn00300  Lysine biosynthesis
ypn01100  Metabolic pathways
ypn01120  Microbial metabolism in diverse environments
ypn01230  Biosynthesis of amino acids
Module
ypn_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ypn00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    YPN_1332
Enzymes [BR:ypn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     YPN_1332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ABG17662
JGI: YPN1332
UniProt: Q1CK18
Position
complement(1512703..1513830)
Genome map
AA seq 375 aa AA seqDB search
MICPVIELAQQLIKRPSLSPSDAGCQEIMIQRLAAIGFTIEPMNFGDTLNFWAWRGEGET
LAFAGHTDVVPTGDESHWHSPPFEPTIRDGMLYGRGAADMKGSLAAMIVAAERFVAAHPD
HKGRLAFMITSDEEAKATNGTVKVVEALMARHERLDYCLVGEPSSTDRVGDIVKNGRRGS
ITANLRIHGVQGHVAYPHLADNPVHRAMPALNELVATQWDEGNAFFPATSMQIANLQAGT
GSNNVIPGEFYVQFNFRFSTELTDSLIKQRVAALLDRHQLDYTLEWVLSGQPFLTAKGAL
VDAVVNAVKHYTEITPQLLTTGGTSDGRFIALMGAQVVELGPVNATIHKVNECVSAADLQ
LLSRMYQKIMEQLIA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgatctgtccggtaatcgaattggcccaacagttaattaaacgcccatcgctcagccct
tcagatgcgggttgccaagagatcatgatccagcgcctagccgccatcggctttaccatc
gaacccatgaattttggtgatacgcttaatttttgggcatggcgtggcgaaggcgaaacg
ctggcatttgctggtcacacggatgtggtgcctaccggtgacgagagccactggcacagc
ccaccgtttgaacccaccatccgtgacggcatgttgtatggccgaggtgccgcagacatg
aaaggctcactggcagcaatgatcgtagcagccgagcgttttgtcgccgcgcaccctgac
cacaaaggccgcctggcctttatgataacctccgatgaagaagccaaagccaccaacggt
acagtaaaagtggttgaagccctgatggcacgccacgagcggctggattattgtctggtg
ggcgaaccatccagtactgaccgggttggcgatatcgtgaaaaatggccgccgtggctcc
atcaccgctaacttgcgtattcatggagtgcaagggcacgtggcgtatcctcatctggcg
gataatcccgttcatcgtgctatgccagcgctgaatgaattggttgccacccaatgggat
gaaggcaatgcgtttttccctgccaccagtatgcaaattgccaatttacaggccggtacg
ggcagcaataatgttattcccggtgaattttatgtgcagtttaacttccgtttcagtact
gaactgactgacagcctgatcaagcaacgggtagccgcattgctggatcgacatcagctt
gattacaccctggaatgggtattgtctggtcaacctttcctgaccgccaaaggggcgttg
gtggatgccgtggttaatgccgttaagcattacactgaaatcacaccgcaactgttaacc
accggggggacgtcagatggccgctttattgcgttaatgggggcgcaagtggttgagttg
gggccagttaatgccaccattcataaagttaatgaatgtgttagcgcggctgatttacaa
ttgctcagccgtatgtaccagaaaatcatggaacaactgatcgcatga

DBGET integrated database retrieval system