KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_1405Help
Entry
YPN_1405          CDS       T00370                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ypn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YPN_1405 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPN_1405 (glk)
   00052 Galactose metabolism
    YPN_1405 (glk)
   00500 Starch and sucrose metabolism
    YPN_1405 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    YPN_1405 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    YPN_1405 (glk)
   00524 Butirosin and neomycin biosynthesis
    YPN_1405 (glk)
Enzymes [BR:ypn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     YPN_1405 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1598630..1599601
Genome map
AA seq 323 aa AA seqDB search
MTTYALVGDVGGTNARLALCAVATGEILQAKTYSGLEYESLEDVIKQYLSEHQAKVTDAC
IAIACPITGDWVAMTNHTWAFSIAAMQQNLGLDHLEVINDFTAVSMAIPVLPAQDVLQFG
GTQPQPGKPVAVYGAGTGLGVAHLVNVDRRWISLAGEGGHVDFAPNSEEEDQILAVLRQE
LGHVSAERVLSGPGLVNLYRAIVISDARLPEKLAPKDITARALADSCTDCRRALSLFCVI
MGRFGGNLALNLSTFGGVYIAGGIVPRFMEFFKASGFRAAFEDKGRFKDFLQDIPVYMIT
HPQPGLLGAGAYLRQKLGYELSS
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgacgacttatgccctggtgggtgacgttggcggtacgaatgcccggttggcgctttgc
gctgttgcaacgggcgagatattgcaagcaaagacatattcagggttggaatatgaaagt
ttagaggatgtaatcaaacaatatctatcagagcatcaagccaaggtcaccgatgcttgt
atcgcgattgcctgcccgattaccggggattgggtcgcaatgaccaatcatacttgggca
ttttctattgccgccatgcaacagaatctgggtctggaccatttggaagtgatcaatgac
ttcaccgcagtctccatggctatccccgtgttacctgcccaagatgttctgcaatttggt
ggcacacagccacagcctggcaaaccggtggcagtgtatggcgcaggtactgggctgggg
gtagcacatttagtgaatgttgatcgccgttggattagtttagcgggagagggcgggcat
gttgatttcgcgcctaatagtgaagaagaagaccagattctggccgtattgcgccaggag
ttggggcatgtttccgctgagcgggtgctatctgggccgggcttagtcaatttatatcgg
gcaattgtgatttctgatgcgcgcctaccagagaaactggcaccgaaagatattaccgca
cgggcgctggcggatagctgtaccgattgtcgccgggcattatcactattttgcgtaatt
atgggccgctttgggggcaatttagcccttaacctcagtacgtttggtggcgtttatatt
gcggggggcatcgtgccgcgctttatggagttctttaaagcctctggttttcgcgctgcg
tttgaagataaaggccgttttaaagatttcttacaagatattccggtgtatatgattact
catccacaacccggtttactgggggctggtgcctatttacgccaaaaattggggtatgag
ttgtcaagctaa

DBGET integrated database retrieval system