KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_1496Help
Entry
YPN_1496          CDS       T00370                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
ypn00900  Terpenoid backbone biosynthesis
ypn01100  Metabolic pathways
ypn01110  Biosynthesis of secondary metabolites
ypn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ypn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    YPN_1496
Enzymes [BR:ypn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     YPN_1496
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C DUF1127
Motif
Other DBs
NCBI-ProteinID: ABG17826
JGI: YPN1496
UniProt: Q1CJK4
Position
complement(1697395..1698294)
Genome map
AA seq 299 aa AA seqDB search
MTTANQPICPSPAKWPSPAKLNLFLYITGQRADGYHQLQTLFQFLDYGDQLTIEPRDDNQ
IRLLTPIAGVENEQNLIVRAAKMLQKHPGNTPVPRGADISIDKCLPMGGGLGGGSSNAAT
VLVALNLLWQCGLTDEQLADLGLTLGADVPVFVRGHAAFAEGIGEKLQPAEPVEKWYLVI
HPGVNIPTPIIFSDPELKRNTPIRPLAALLSTPYANDCEPIARKRFREVEQALSWLLEYA
PSRLTGTGACVFAEFDTESSARQVLSIAPEWLHGFVARGVNVSPLHRVRSGKIESSERR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgactaccgcgaatcaacctatatgtccgtcaccagcaaaatggccgtcaccggcaaaa
ttgaatttgtttctttatatcaccgggcaacgcgccgacggctatcatcagttacaaacg
ctgtttcaatttcttgattatggtgatcaactgacgattgaaccgcgcgatgacaaccaa
attcgcttattaacccccatagcaggggtggaaaatgagcaaaacctgatcgtccgcgcg
gcaaaaatgctgcaaaaacaccctggcaatacccccgtgccacgcggtgctgatatcagc
attgataaatgtttaccgatgggcggtggattggggggcggttcgtctaatgcagccaca
gtcttggtggcactcaacctactgtggcaatgtggtttaactgatgaacaattagccgat
ctcggactaacattaggggctgatgtcccggtatttgttcggggccatgccgccttcgca
gagggtattggtgaaaaattacagccagcagagcctgtagagaagtggtatttggtcata
caccccggtgtaaacatcccaacaccgattattttttctgatcctgaattaaaaagaaat
acgccaatccgcccactggcggcgcttttaagcactccatacgcaaatgattgcgaaccg
atcgcaagaaaacgttttcgcgaggttgaacaggctctttcatggctgttagaatacgcc
ccgtcacgccttaccggtaccggcgcttgtgtgtttgcagaattcgacacggagtcatcg
gcccggcaggtgttaagtattgcccctgagtggttacatggttttgtcgcccgtggtgta
aatgtttcaccattgcatcgtgtacgctcagggaaaattgaaagcagtgagcgcagataa

DBGET integrated database retrieval system