KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_1570Help
Entry
YPN_1570          CDS       T00370                                 

Definition
phage lysozyme
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Brite
Enzymes [BR:ypn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     YPN_1570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1779918..1780430
Genome map
AA seq 170 aa AA seqDB search
MATIKRIASGSACAVAVIIAIVISAGNVRTSERGLELIGNAESCRRDPYACPAGVLTDGI
GNTHGVKAGVIKTDTQIAEDWEKNILDAERCVIRYANGNKLPPSAFDAATSISFNAGCSL
MQKSTMFKYFRAGNVTAACEQFPRWIYGGGKKLPGLVTRREKEKALCLES
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaataaaacgcattgcctccgggtctgcttgtgctgttgcagtcatcatcgcg
attgttatttcggcgggcaacgtaagaactagcgaacgaggacttgagctgatcggcaat
gctgaatcatgccgccgcgacccatacgcttgtccggctggagtactgactgatggcatt
ggcaacactcatggcgtcaaggctggagttattaagaccgacactcagatagccgaagat
tgggaaaagaacattcttgatgctgaacgctgcgtcattcgctatgcaaatggcaataaa
ttaccgcccagcgcttttgatgccgctacgtcaatcagctttaacgccggttgctcattg
atgcagaaatccacaatgttcaagtattttcgcgctggtaacgtgacagcggcctgtgaa
cagttcccgcgctggatatatggtggcggtaaaaaattgccggggctggtgactcgtcgc
gagaaggagaaggcgctatgcctggaaagttaa

DBGET integrated database retrieval system