KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_1646Help
Entry
YPN_1646          CDS       T00370                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ypn00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    YPN_1646
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPN_1646
   00620 Pyruvate metabolism
    YPN_1646
   00650 Butanoate metabolism
    YPN_1646
  Lipid metabolism
   00071 Fatty acid degradation
    YPN_1646
  Amino acid metabolism
   00350 Tyrosine metabolism
    YPN_1646
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    YPN_1646
   00626 Naphthalene degradation
    YPN_1646
Enzymes [BR:ypn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     YPN_1646
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     YPN_1646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1861228..1863903)
Genome map
AA seq 891 aa AA seqDB search
MAVTNVAELNELVARVKKAQREYANFSQEQVDKIFRAAALAAADARIPLAKLAVTESGMG
IVEDKVIKNHFASEYIYNAYKDEKTCGILCEDKTFGTITIAEPIGLICGIVPTTNPTSTA
IFKALISLKTRNGIIFSPHPRAKDATNKAADIVLQAAIAAGAPADIIGWIDAPTVELSNQ
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVVDETADIKRVVASILMSKTF
DNGVICASEQSIIVVDSVYDAVRERFASHGGYLLQGKELKAVQDIILKNGGLNAAIVGQP
ATKIAEMAGIKVPSNTKILIGEVKVVDESEPFAHEKLSPTLAMYRAKNFEEAVEKAEKLV
EMGGIGHTSCLYTDQDNQTARVKYFGDKMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALEEVATDGAK
RAFIVTDRYLFNNGYADQVTSVLKSHGIETEVFFEVEAAPTLSIVRKGAEQMNSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKLVAITTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMNMPKSLCAFGGLDAVTHALE
AYVSVLANEYSDGQALQALKLLKEFLPASYNEGAKNPVARERVHNAATIAGIAFANAFLG
VCHSMAHKLGSEFHIPHGLANAMLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAQKIQKLLAWLDEIKAELGIPASIREAGVQEADFLAKVDKLSEDAFDDQ
CTGANPRYPLISELKQILMDTYYGREYVEEFDREEEVAAATAPKAEKKTKK
NT seq 2676 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaacgaatgtcgctgaacttaacgagctagtagcacgcgtcaagaaagcccag
cgcgagtatgccaacttttcgcaagagcaagttgataaaatcttccgtgctgcagcatta
gccgctgcggatgcccgtattccactagccaaactggctgtaacagagtctggcatgggt
attgttgaagacaaagtgatcaaaaaccactttgcttctgaatatatttacaatgcttat
aaagatgaaaaaacctgtggtattttgtgtgaagataagaccttcgggacgatcactatc
gcagaacctattggtctaatctgcggtatcgtaccaaccactaaccctacgtctaccgct
atttttaaagcactgattagcttgaagacacgtaacggtattatcttctccccacatcca
cgcgctaaagacgcaaccaataaagctgcggatatcgtgcttcaagccgctatcgcagca
ggtgcgccagcggatattattggttggattgatgctccaacagttgaattatctaatcaa
ctgatgcatcacccagacattaatcttattctggcaaccggtgggccaggtatggttaaa
gcggcctatagctctggtaaaccagccatcggcgtaggtgcgggtaatacgccagtcgtc
gttgacgaaactgcagatattaaacgtgttgtcgcatctattctgatgtctaaaaccttt
gataacggtgttatctgcgcgtcagagcagtccatcatcgttgttgactcggtttacgat
gcggttcgcgagcgttttgcttctcatggtggctacctgttacaaggtaaagaattgaaa
gccgttcaggatattatcctgaaaaatggcggtctaaacgcagccatcgtgggccagcca
gcaactaagatcgctgagatggctggcattaaagtgccaagtaataccaagatacttatc
ggtgaagtcaaagttgtcgatgaatcagagccatttgctcatgaaaaactgtcgcctaca
ctggcaatgtatcgtgctaaaaactttgaagaagcggttgaaaaagcagagaaactggtg
gagatgggcggtatcggtcatacctcttgtctgtacaccgaccaagataaccagactgca
cgcgttaaatatttcggcgataaaatgaagaccgcccgaattctaatcaacacccctgcc
tctcaaggtggtatcggtgacttgtataacttcaagctggcaccgtctctgacgctgggt
tgtggttcttggggtggtaactccatctctgaaaacgtcggtccgaaacacttgatcaac
aagaaaactgtggctaagcgagcagaaaacatgttgtggcataaactaccgaaatctatt
tacttccgtcgcggctctctgcctatagcgttggaagaagtggcaactgacggtgcaaaa
cgtgccttcatcgtgactgaccgctacttgttcaacaacggttatgcagaccaagtcacc
agcgtactgaaatctcacggtattgaaactgaagttttcttcgaagtagaagctgcccct
accctgagtatcgtgcgtaaaggtgcagagcagatgaactccttcaagccagacgttatt
attgctctgggtggtggttcaccgatggatgctgcaaaaatcatgtgggtaatgtacgaa
catcctgaaacgcatttcgaagaactggcattgcgttttatggatatccgtaaacgcatt
tataagttcccgaaaatgggtgtaaaagcgaaattggtcgctattacaaccacatcaggt
accggttcagaagtcaccccgtttgccgtggttactgatgacgcaacaggccagaaatat
ccattggcagactatgcattgacaccagatatggccattgttgatgccaaccttgttatg
aatatgcctaagtctctgtgtgccttcggtggtctggatgcagtaacgcacgcactggaa
gcctatgtgtctgtactggctaatgaatactctgacggccaggcgctgcaagcactgaag
ctgttgaaagaattcttgccagccagctacaacgaaggggctaaaaacccagttgctcgc
gaacgtgtacataatgcagcaacaattgccggtatcgcctttgctaacgccttcttgggt
gtctgtcactctatggcccacaaactgggttctgagttccatatcccacacggcttggca
aatgctatgttgatttctaacgttattcgctacaacgcgaatgacaacccaacaaaacag
actgccttcagccaatatgaccgcccacaagcgcgtcgtcgttatgcagaaattgcagat
catttggggctgagtgcaccgggcgaccgtactgcacaaaaaatccagaaactgctggct
tggttagatgaaatcaaagctgaactgggtatcccggcatcgattcgcgaagcgggtgtt
caggaagctgacttcttagctaaagtagacaaattgtctgaagatgcatttgatgaccag
tgcacaggtgctaacccacgctacccactgatctcagagctgaaacagatccttatggat
acttattacggtcgcgaatatgttgaagagtttgaccgcgaagaagaagtcgcggcagct
actgcgcctaaagctgagaaaaagaccaaaaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system