KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_1952Help
Entry
YPN_1952          CDS       T00370                                 

Definition
(GenBank) protein-glutamate methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
ypn02020  Two-component system
ypn02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ypn00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    YPN_1952
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    YPN_1952
Enzymes [BR:ypn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     YPN_1952
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     YPN_1952
Two-component system [BR:ypn02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   YPN_1952
Bacterial motility proteins [BR:ypn02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    YPN_1952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: ABG18281
JGI: YPN1952
UniProt: Q1CI99
Position
complement(2202187..2203236)
Genome map
AA seq 349 aa AA seqDB search
MSKIRVLCVDDSALMRQLMTEIINSHPDMEMVAAAQDPLVARDLIKKFNPQVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKNSEITMRALELGAIDFVTKPQLGIREGMLAYS
ELIADKIRTAAKARLPQRVLENKPAMLSHTPLLSSEKLIAIGASTGGTEAIRAVLQPLPP
TSPALLITQHMPPGFTRSFAERLNKLCQITVKEAEDGERVLPGHAYIAPGDRHLELARSG
ANYQVRIHDGPAVNRHRPSVDVLFRSVAQYAGRNAVGVILTGMGNDGAAGLLEMHRAGAY
TLAQNEASCVVFGMPREAIAMGGVNDVVELNQISQRMLAQISSGQALRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatcagagtattgtgtgttgatgattctgcattaatgcgtcagctaatgact
gagattattaacagtcacccggatatggagatggttgctgcggcacaggatccgttggtt
gcccgtgatttgatcaaaaaatttaatccacaagttttgacgcttgacgtggaaatgcct
cgcatggatggcttggattttctcgagaaattgatgcgtctacggcccatgccggtggtg
atggtgtcttccctaacgggtaaaaactccgaaataaccatgcgggcgttggagttgggg
gcgattgattttgtcaccaaacctcagttagggatccgcgaaggaatgctggcttacagc
gaactgattgccgataagatccgcacggcggctaaggctcgtttaccacagcgcgtcctg
gaaaataaaccggcgatgctcagccataccccattgctcagcagtgaaaaattgatcgcc
attggggcatcaactggcggtactgaggcgattcgtgcggtattacagcctttgccacca
accagtccggcattgctgatcactcagcatatgccgccgggatttacccgttcgtttgct
gaacgcttgaataaactgtgccaaatcacggtaaaagaagcagaggatggcgagcgagta
ttaccgggacatgcctatattgcacccggtgatcggcacttggaactggcccggagtggt
gccaactaccaggtgcggatccatgatggacccgcggttaatcgtcaccgtccttcggtt
gacgttcttttccgttcggtggcgcagtatgccgggcgcaatgcggtcggggtgatcctc
acggggatgggcaatgatggagccgctggcttgctggagatgcaccgggcgggtgcctac
accctcgcgcaaaatgaggccagctgcgtggtctttggtatgccacgtgaggcgattgcg
atggggggggttaatgacgtcgtggagttgaaccaaataagtcagcggatgttggcgcag
atcagtagtggtcaagcccttcgcatatag

DBGET integrated database retrieval system