KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_2200Help
Entry
YPN_2200          CDS       T00370                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase / short chain enoyl-CoA hydratase (EC:1.1.1.35 4.2.1.17)
  KO
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ypn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YPN_2200
   01212 Fatty acid metabolism
    YPN_2200
  Carbohydrate metabolism
   00640 Propanoate metabolism
    YPN_2200
   00650 Butanoate metabolism
    YPN_2200
  Lipid metabolism
   00071 Fatty acid degradation
    YPN_2200
   01040 Biosynthesis of unsaturated fatty acids
    YPN_2200
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YPN_2200
   00310 Lysine degradation
    YPN_2200
   00380 Tryptophan metabolism
    YPN_2200
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YPN_2200
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    YPN_2200
   00281 Geraniol degradation
    YPN_2200
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    YPN_2200
   00930 Caprolactam degradation
    YPN_2200
Enzymes [BR:ypn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     YPN_2200
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     YPN_2200
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     YPN_2200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(2485151..2487475)
Genome map
AA seq 774 aa AA seqDB search
MSKENIVTRENTAVSENAVSEPTVNNDVGASATNSVTHPAFTLNVRPDNIGIITIDVVGD
KVNTLKAEFADQIATILQQAHALPKLQGLVIVSGKPDSFIAGADITMIAACRTAHDARVL
AQKGQSILAQIAAFPVPVVAAIHGACLGGGLELALACHSRICSLDDKTVLGLPEVQLGLL
PGSGGTQRLPRLVGVSKALDMILTGKQIRPRQALKMGLVDDVVPRDILLDVAIQRAKAGW
LNRRALPWQERLLSGPLGKALLFRIVRKKTLAKTRGHYPAAERIIDVVRKGLDQGGPSGY
EAEARAFGELAMSPQSAALRSLFFATTSLKKETGSAATARAIHRVGVLGGGLMGGGIANV
TATRAGLPVRIKDINPQGINQALKYTWDALGKRVRSKRMRPTEQQRQMMLISGSTDYRGF
ERVDIVVEAVFEDLSLKQQMVADIERFGAAHTIFASNTSSLPISQIAALAQRPEQVIGLH
YFSPVDKMPLVEVIPHEKTSEETIATTVALARKQGKTAIVVADRAGFYVNRILAPYINEA
ARCLLDGEPIESVDNALVDFGFPVGPMMLLDEVGIDVATKIMPILVEQLGPRFAAPPSFD
VILKDGRKGRKNGRGFYLYSNPTKNSSPTKNGNSPAKRNSFKWRKNKVKPVDASIYTLLG
VTPKAHLGAGVITQRCTMLMLNEAVRCLDESIIRNPRDGDIGAVFGIGFPPFLGGPFRYL
DSLGADKVVQALRLLVQQYGERFEPCQRLVTMAEQQQQFYPVDANIDEVTDVAS
NT seq 2325 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggaaaatatcgttacccgtgaaaatacagctgtcagtgaaaatgcagtcagt
gaacctacagtgaataatgatgtgggcgcatcggccacgaattcagttacccatcccgca
tttaccctcaacgtaaggccggacaatattggcattatcaccattgatgttgttggtgac
aaagtgaataccctaaaggctgaatttgctgatcaaattgccactatattgcaacaagcg
cacgctctaccaaaattacagggactcgtcattgtttctggcaaaccagactccttcatt
gccggtgcggatatcacgatgatcgcggcttgtcgtaccgctcacgacgcccgcgtatta
gcacaaaaaggccaatcaattttggcgcaaattgccgctttccctgtgccggttgtggct
gcgattcatggcgcttgtctggggggagggctagagctggcgctggcttgccatagccgc
atatgttctctggatgataaaaccgttctcgggctaccggaggtgcaactggggttactg
cctggctccggcgggacgcaacgtctgccgcgtttagtgggggtcagtaaagcactggat
atgatattgaccggtaaacagatacggccccgtcaggcactaaaaatggggctggtggat
gatgttgtgccacgcgatatcttattggatgtggcgattcagcgcgcgaaagcggggtgg
cttaatcgacgagcattaccatggcaggagcgtttactcagtgggccgttgggtaaagct
ttattattccgtattgtccgtaaaaaaacgctagctaaaacgcgggggcactacccggcg
gctgaacgtattattgatgtggtgcgtaaaggattagatcagggcgggccaagtggttat
gaggcagaagccagagcatttggcgagttggcgatgtcgcctcagtcagccgcattacgc
agcctgttttttgccacgacgtcactgaaaaaagagaccggaagtgcagccacagcgcgt
gcaattcatcgggtcggcgtattgggcggtggcttgatgggcggaggtattgccaacgta
acggctacccgagcgggcttgccagtgcgtatcaaagatatcaatccgcaaggaattaat
caggcgctgaaatatacctgggacgcattgggtaaacgggttcgtagtaagcggatgcgc
ccaactgaacagcagcggcagatgatgttgatctctggtagtacggattaccgtggtttt
gaacgtgtcgatattgtggtggaagcggtatttgaggatttatcactgaagcagcaaatg
gttgctgacatcgaacgatttggtgccgcccatactatttttgcctccaatacatcatca
ctccccatcagccagattgctgctttggcgcaacggccagagcaggttattggcctgcac
tattttagtccagtagataaaatgccactggttgaagtcatcccccatgaaaaaaccagt
gaagagaccatcgctaccaccgttgctttagcccggaaacagggtaaaacagccattgtg
gtggctgatcgcgctgggttctatgtaaaccgcattttggcaccttatattaatgaagct
gcccgttgcctgctcgacggagagcctatcgaatcagttgataacgcgttggtcgatttt
ggtttccccgtaggccccatgatgctgcttgatgaggttgggattgatgttgcgaccaaa
ataatgccgattctggtcgagcaattagggccgcgttttgctgcgcccccgtcatttgac
gttattttgaaggatggacgtaaagggcgcaaaaatggccgtggcttttatttatattca
aaccccacaaaaaattcatctccaacaaaaaatgggaattctccggcgaagcgtaatagc
tttaagtggagaaaaaacaaagtaaaaccagtcgatgccagtatctataccttgttgggg
gtgacacctaaagcccatcttggtgcaggcgtgattactcaacgttgtaccatgctgatg
ttgaacgaagcggtacgctgtctggatgaatcgatcattcgtaacccgcgcgatggtgat
attggtgcagtgtttgggatcggttttccgcctttcctcggtggtccgttccgctatttg
gatagcctgggagccgataaggtggtacaagcactcagattattggtacagcaatacggt
gagcgtttcgaaccttgccagcggttggtaacaatggctgaacaacaacaacaattctat
cccgtggacgccaatatagatgaggtgacggacgtggcaagctga

DBGET integrated database retrieval system