KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_2431Help
Entry
YPN_2431          CDS       T00370                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
ypn00340  Histidine metabolism
ypn01100  Metabolic pathways
ypn01110  Biosynthesis of secondary metabolites
ypn01230  Biosynthesis of amino acids
Module
ypn_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ypn00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    YPN_2431
Enzymes [BR:ypn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     YPN_2431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh SIP
Motif
Other DBs
NCBI-ProteinID: ABG18759
JGI: YPN2431
UniProt: A0A0H2YKE0
Position
2720802..2722133
Genome map
AA seq 443 aa AA seqDB search
MQPTNFNTLINWQQCSEEQQKALLSRPAINASERITAAVSDILDRVKAEGDSALRDFSQR
FDHVQVADIRITASEIAAASARLSDDVKHAMAQAVRNIEIFHNAQKMPVVDVETQPGVRC
QQITRPIASVGLYIPGGSAPLPSTVLMLGTPARIAGCQRVVLCSPPPIADEILYAAQLCG
IQEVFQIGGAQAIAAMAFGSESVPKVHKIFGPGNAYVTEAKRQVSQRLDGAAIDMPAGPS
EVLVIADSGATPAFIAADLLSQAEHGPDSQVILLTPDAAIAQAVAVEVEQQLALLSRADI
ARQALESSRLIVTNDLQQCIDISNAYGPEHLILQIRQPEEIIDQIDNAGSVFMGDWSPES
AGDYASGTNHVLPTYGYTSTYSSLGLADFVKRMTVQQLTPQGLLGLASTIETLAQAEQLT
AHKNAVTLRVTALNNALTAVNKE
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgacgaatttcaataccctgatcaattggcaacaatgcagtgaagaacagcaa
aaagcgctgttgagccgcccagccatcaatgcatccgagaggatcactgcggcggtcagt
gacatcctggaccgggtgaaagcggaaggcgatagcgccctgcgtgattttagccagcgt
tttgaccatgtgcaggtcgcggatatccgtatcactgcatcagagatcgctgcggcctcg
gcgcgcctgagtgacgatgtcaagcacgccatggcacaggcggtacgtaatattgaaatc
ttccacaatgcgcagaaaatgccggtggtggatgttgaaactcagccgggtgtgcgttgt
cagcaaatcacgcgtccgattgcttccgtcggcttgtatattcccggtggttctgcaccg
ttgccatcaaccgtactgatgctcggcaccccagcacgtattgccggttgtcagcgggtc
gttttatgttctccaccgcctattgccgatgaaattttgtatgccgctcaactgtgcggt
attcaggaagtgttccagatcggcggggcacaagcgatcgccgccatggcattcggcagt
gaatcggtgcctaaagtgcacaaaatttttgggccgggcaacgcttatgttactgaggca
aaacgtcaggttagccagcgcctggacggtgctgccatcgatatgcccgcaggcccatca
gaggtgttggtgatcgccgacagcggtgctacacctgcgtttatcgcggcggatttactc
tcacaagcggaacacgggcctgattctcaagtgatcttactgacacctgatgccgctatc
gcacaagcggtggcagtcgaagttgagcaacaactcgcgctgttatcccgagccgatatt
gcccgtcaggcactggaaagcagccgtttgatcgtgaccaacgatttacagcaatgcatt
gatatcagtaatgcatacggccctgagcatttgattctacaaattcgtcaaccagaagaa
atcattgaccagattgataacgctggctccgtgtttatgggcgattggtcaccggaatcg
gctggggattacgcctcgggcaccaaccacgtactgccaacctacggttatacctcaacc
tattccagtttaggtttggctgattttgttaagcgcatgaccgtacagcaattgacacca
cagggtttgttagggctggcctccaccatcgaaacactggcacaggccgaacaactgacc
gcacacaaaaatgcagttaccctgcgcgttaccgccttgaataacgccctgaccgccgtg
aataaggagtaa

DBGET integrated database retrieval system