KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_2867Help
Entry
YPN_2867          CDS       T00370                                 

Definition
(GenBank) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:ypn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YPN_2867
   01230 Biosynthesis of amino acids
    YPN_2867
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPN_2867
  Energy metabolism
   00680 Methane metabolism
    YPN_2867
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YPN_2867
Enzymes [BR:ypn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     YPN_2867
Exosome [BR:ypn04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   YPN_2867
  Exosomal proteins of melanoma cells
   YPN_2867
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3224786..3225538
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGRSEAKAAGKLLKDEGFTFDFAYTSVL
KRAIHTLWNILDELDQAWLPTEKTWKLNERHYGALQGLNKSETAEKYGDEQVKQWRRGFA
ITPPALEKSDERFPGHDPRYAKLTDAELPTTESLALTIERVIPYWNDVIKPRIASGERVI
IAAHGNSLRALVKYLDDLGEDEILELNIPTGVPLVYEFDENFKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggcagtaactaagctagttttggtacgacacggcgaaagtcaatggaacaacgaaaac
cgcttcaccggttggtatgatgttgatctgtctgaaaaaggccgttctgaagcaaaggca
gcgggtaagctgttaaaagatgaaggcttcacttttgatttcgcctacacctcagtatta
aaacgcgctatccacaccttgtggaacattttggatgaattagatcaggcatggctgcca
acagaaaaaacctggaagcttaacgagcgtcactacggcgcactgcaaggcctgaataaa
tctgaaacggctgaaaaatacggcgatgagcaggttaagcaatggcgtcgtggctttgcc
atcacccctccagcactggagaaaagcgatgagcgtttcccaggccatgacccacgttat
gcaaaattgactgatgctgagctgccaaccacagaaagcttggcgctgactattgaacgc
gtgattccctactggaatgacgttatcaaaccacgtattgccagcggtgaacgcgtaatt
attgctgctcacggtaactctttacgtgcattggtaaaatatctggatgatctgggcgaa
gacgaaattcttgagctgaacatcccaactggcgtgccattagtgtatgagtttgatgag
aacttcaagcctatcaaacactactatctgggtaacgctgatgaaatcgccgctaaagct
gcagcggttgctaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system