KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_2888Help
Entry
YPN_2888          CDS       T00370                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
ypn00020  Citrate cycle (TCA cycle)
ypn00190  Oxidative phosphorylation
ypn00650  Butanoate metabolism
ypn01100  Metabolic pathways
ypn01110  Biosynthesis of secondary metabolites
ypn01120  Microbial metabolism in diverse environments
ypn01130  Biosynthesis of antibiotics
ypn01200  Carbon metabolism
Module
ypn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ypn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ypn_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ypn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YPN_2888
   00650 Butanoate metabolism
    YPN_2888
  Energy metabolism
   00190 Oxidative phosphorylation
    YPN_2888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ABG19215
JGI: YPN2888
UniProt: A0A0H2YLF9
Position
complement(3249756..3250103)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDWLLLRASAIVITLYVFYILGFVVIVPDITYEIWRGFFASHITKVF
TLLTLLSILAHAWIGLWQVLTDYIKPLAIRLVLQLVVVITLLVYLLYGTIVVWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaatgcttctgcgttagggcgtaatggagtacacgattggttgttactgcgt
gcttctgcaatcgtcatcaccctgtatgtcttttatattctgggcttcgttgtgattgtc
ccagacatcacctatgaaatctggcgcggtttcttcgcgtcacacatcacaaaagtattt
acgctgctgacattgctgtcgattctagctcacgcttggatcggtctatggcaggtattg
acggactatataaagccactggcgatacgactggtgttacaactggtcgtcgtgattacg
ctgttggtttatttattgtatggaacaattgtggtgtggggagcttaa

DBGET integrated database retrieval system