KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_2952Help
Entry
YPN_2952          CDS       T00370                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
ypn00900  Terpenoid backbone biosynthesis
ypn01100  Metabolic pathways
ypn01110  Biosynthesis of secondary metabolites
ypn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ypn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    YPN_2952
Enzymes [BR:ypn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     YPN_2952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: ABG19279
JGI: YPN2952
UniProt: Q1CFF1
Structure
PDB: 

Jmol
Position
complement(3313749..3314945)
Genome map
AA seq 398 aa AA seqDB search
MKQLTILGSTGSIGNSTLSVVRANPELFKVTALVAGRNVREMAQQCLEFSPRYAAMSDEH
SAKSLRLLLAEQGSDTEVYSGETAACELAALDDVDQVMAAIVGIAGLPSTLAAIRAGKQV
LLANKESLITCGKLFMDEVKRSRAQLLPIDSEHNAIFQSLPERIQRQLGYSSLNENGVSR
IILTGSGGPFRETPLSQFSDVTPDQACAHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ASAEQIEVVLHPQSVIHSMVRYHDGSILAQMGTPDMRTPIAHAMAYPMRVSSGVAPLDFC
KVGALTFTTPDYQRYPCLKLAIDACNAGQAATTALNAANEISVMAFLDSKIRFTDIEVIN
RTVVEGLLLSEPTSVEEVLVIDRKARDVAAQVIAKLNN
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaactgactattcttggctctactggctccatcggcaacagcacgttgagtgtt
gtgcgtgcaaaccctgaattatttaaagtcacggcgttagttgccgggcgtaatgtcagg
gaaatggcgcagcaatgccttgagttctccccccgctatgcagctatgtctgatgaacac
tcagctaaatcactgcgtttattgttggcagaacagggttcagacaccgaggtctattcc
ggtgaaacggctgcctgcgaattggcagctttagatgatgtcgatcaagtgatggccgcg
attgttggcattgctggtttaccctcaacattggccgctattcgtgcaggtaaacaagtc
ttgcttgccaataaagagtcgctgattacctgcggtaaactctttatggatgaggttaaa
cgcagccgtgctcaattactgccaattgatagcgagcataacgcgatttttcagagtttg
cctgaaagaattcagcgccaattaggctattcttcattaaatgaaaatggcgtttcacgg
attattttgactggctctggtggcccatttcgtgaaactccactttcgcagttttctgat
gtcaccccagatcaagcttgtgctcatccaaattggtctatggggcggaaaatttctgtc
gactcagcgacgatgatgaataaaggcctggagtatattgaggctcgatggttatttaat
gccagcgcagaacagatagaggttgtgttacatccgcagtctgttattcactcgatggtt
cgctatcatgacggaagtatcctggcacaaatggggactccagacatgcggacaccgatt
gcacatgcgatggcttacccaatgcgagttagctcaggtgttgcgccattggatttttgc
aaagtaggcgcgctgacctttacaaccccggattatcaacgttatccgtgcttaaagttg
gccatagacgcctgtaatgcggggcaggcagcgacaacagcgctgaatgcagcaaatgaa
atttcagtcatggcatttttagattcaaaaattcgtttcactgatattgaagtgattaac
cgtactgttgttgaaggtttattattatcagaacctaccagtgtggaagaggtgttggtg
attgatcgcaaagctcgtgatgtcgcggcccaagtcattgcaaaattaaataattaa

DBGET integrated database retrieval system