KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_3416Help
Entry
YPN_3416          CDS       T00370                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
ypn00010  Glycolysis / Gluconeogenesis
ypn00620  Pyruvate metabolism
ypn00640  Propanoate metabolism
ypn00680  Methane metabolism
ypn01100  Metabolic pathways
ypn01110  Biosynthesis of secondary metabolites
ypn01120  Microbial metabolism in diverse environments
ypn01130  Biosynthesis of antibiotics
ypn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ypn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPN_3416
   00620 Pyruvate metabolism
    YPN_3416
   00640 Propanoate metabolism
    YPN_3416
  Energy metabolism
   00680 Methane metabolism
    YPN_3416
Enzymes [BR:ypn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     YPN_3416
Lipid biosynthesis proteins [BR:ypn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   YPN_3416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABG19743
JGI: YPN3416
UniProt: Q1CE37
Position
3892225..3894183
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHPIPAAIAEHALITPEKYQHYYQQSVQNPDEFWGEQGKIIDWIKPYKTVKNTSF
DPGHVSIRWFEDGTLNLAANCLDRHLAERGDQTAIIWEGDDPNQSKTVTYKQLHHDVCQF
ANVLKSLGVKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPDAVAGRIIDSHS
KLVITADEGIRAGRAIPLKKNVDEALKNPAITSIKNVVVFQRTGNASYWEDGRDVWWHDL
IKEASADCPPEEMNAEDPLFILYTSGSTGKPKGVVHTTGGYLVYAALTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGAITLMFEGVPNYPGVNRLSQVVDKHKVNILYTAPTA
IRALMAEGDKAIEGTKRDSLRIMGSVGEPINPEAWEWYYNKIGNSKCPIVDTWWQTETGG
FMITPLPGATELKAGSATRPFFGVQPALVDNLGNPQEGVAEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KIAEAAVVGVPHNIKGQAIYAYITLNHGEEPTPELYTEVRNWVRKEIGPLATPDILHWTD
SLPKTRSGKIMRRILRKIATGDTSNLGDTSTLADPSVVEKLLEEKQSMQTPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaatacataaacatcctattccagctgcaattgcagagcatgctctaattacc
ccagaaaaataccaacattattaccaacaatccgtgcagaaccctgatgaattctggggc
gaacaaggcaaaatcattgattggattaaaccctataaaacggtaaaaaatacctccttt
gaccccggtcatgtgagtatccgctggtttgaggacggtacattgaacctcgcggcgaat
tgccttgatcgccatttggcagagcgtggtgatcaaacagccatcatttgggaaggtgat
gaccctaatcaatcaaaaaccgtcacttataagcaactgcaccatgatgtgtgccagttt
gctaatgtcctaaaaagtttaggcgtcaaaaaaggcgatgtggttgccatctatatgcca
atggtgcctgaagctgccgtggcgatgttggcttgcgcgcgcatcggcgctgttcattcc
gttatctttggtggattttctccagatgccgttgccgggcgtatcatcgattctcactct
aaactggtgattactgccgatgaaggtatccgtgcaggccgtgctattccactgaaaaaa
aatgtcgatgaagcactgaaaaaccccgctatcaccagtattaaaaatgttgtggtcttc
caacgtactggtaacgccagctattgggaagatgggcgcgatgtatggtggcatgacctg
ataaaagaggcatccgctgactgcccgccagaagagatgaatgcagaagacccgctgttc
atcctttatacctctggctctaccggtaaacctaaaggggttgtacatacgacgggcggt
tatctggtttatgctgcactgacattcaaatatgtctttgattatcaccctggcgatatc
tactggtgtactgcagacgttggctgggtaaccggacacagctatctgttatatggacca
ctggcttgtggggccatcactctaatgtttgaaggcgtgcctaactaccctggcgtcaat
cgcttaagccaagttgttgataaacataaagtcaatattctatacaccgcgcctacagcg
attcgggccttaatggccgaaggtgacaaagccatcgaaggaaccaaacgcgactcactg
cgtattatgggatcggtcggcgagccgattaatccagaagcctgggaatggtattacaac
aagatcggtaacagtaaatgcccgattgtcgatacttggtggcagactgaaaccggtggt
ttcatgataacccctctgccgggtgccaccgagttgaaagccggttccgcaacgcgtcca
ttctttggggtacaacctgcgttggtagataacctgggcaatcctcaggaaggggtggca
gaaggtaatctggtcataaccgactcatggccggggcaagccagaacattatttggcgat
catgaacgtttcgaacaaacctacttctcaacctttaaaggcatgtatttcagtggcgac
ggcgcacgtcgtgacgaagacggttactactggataaccggtcgagttgatgacgtacta
aacgtttcaggccatcgcttaggaacggctgaaattgaatctgcattggttgcacacccg
aaaattgccgaagcggctgttgtcggtgttccacataatattaaaggacaggctatttat
gcctatatcacgctaaatcacggtgaagaaccaacgccagagttatataccgaagtacgc
aactgggtacgtaaagagattggcccactcgcaacacccgatattttgcattggacggac
tcattacccaaaacccgttcaggcaagatcatgcgccgtattttacgcaaaattgcgaca
ggagataccagcaacttgggcgatacctcaacacttgccgatccaagcgtggtagaaaaa
ttactagaagaaaaacaatcaatgcagacaccgtcgtaa

DBGET integrated database retrieval system