KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_3549Help
Entry
YPN_3549          CDS       T00370                                 

Definition
carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ypn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    YPN_3549
Enzymes [BR:ypn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     YPN_3549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4050627..4051556
Genome map
AA seq 309 aa AA seqDB search
MSVFILGSYAKALVMTTDRIPLAGETLIGYDFRQTWGGKGSDMAVQAVRLGAEVAYAGVV
GDDTFGHEFVGLMQEEGVNIDALTISGELPTGAGLIVKDKEARNVIVVDMGANKLFTPAL
VDSALSQLKQSNVVLTQLEIPLETARYGLQRAKEFGKITILNPAPARDLRGLDLSAIDYL
TPNETEARVALGLPPDDPRSNREIANLLLETGCQYVVMTLGESGSAVFGRNDTQEIPPCI
IDVVDSNGAGDSFNAALAVALDEGLPISEAVLFANATAALCCMDWETVPSYRYREDVDAF
MRSITVKEE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtatttattctcggcagctatgcgaaagcgctggtgatgaccaccgaccgtatt
cctctggctggggaaacgctgattggctatgactttcgccagacgtggggcggtaaaggc
tcggatatggcggttcaggcagtgcgtctgggggcagaggtcgcctatgcgggtgtcgtc
ggtgatgacacctttggccatgaatttgtcggcttgatgcaggaagaaggcgtcaatatc
gacgcattaaccatcagcggagaattaccaacgggggcgggacttatcgttaaagataaa
gaagcccgtaacgtgattgtcgtggatatgggggccaataaactgtttaccccagcgttg
gtggacagcgccttatcccagctcaaacaaagcaatgtggtgctcacacagcttgaaatt
ccgctggaaacggcacgttacggactccaacgggcaaaagaattcggcaaaataaccatc
ctgaacccggctccggcaagggatctgcgcggtctcgatctcagcgcgattgattatttg
acccctaatgaaacggaagcccgcgtggctctgggtctgcctccggatgacccacgcagc
aaccgagagattgccaacctcttactggaaaccggttgccaatatgtcgtgatgacgctg
ggtgaatcaggttctgcggtatttggtcgcaacgacacacaagaaatccccccctgcatc
attgatgtcgtcgacagtaacggtgcaggtgacagctttaacgcggcactggccgtcgcg
ctggatgaagggctgccgattagcgaagctgtgctgtttgctaacgccacggcggcgttg
tgctgtatggattgggaaacggttccgtcctatcgctaccgcgaagatgtcgatgctttt
atgcgatctataaccgtgaaagaggaataa

DBGET integrated database retrieval system