KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_3647Help
Entry
YPN_3647          CDS       T00370                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
  KO
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YPN_3647
Enzymes [BR:ypn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     YPN_3647
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(4181824..4182723)
Genome map
AA seq 299 aa AA seqDB search
MFERLLAWTENNLAAGDLTSRLPAWLWGQNSQNNWDILDPNSASDADILIAYNLLEAGRL
WGNRRYLIMGTLLLQRIAQEEVMDIPGLGQMLLPGKIGFNDEDTWRLNPSYLPPQLLARF
SSIDGPWEAMVEVNQRMWLETAPNGFSLDWVVWQKGKGWQPDTIKPDVGSNDAILVYLWA
GMLAMDSPQKAELIARFQPMAVITQQQGLPPFTTNSDNGKTNGDGAVGFSAALLPFLASS
PEPFNQQTLNLQQRRVQNSPPGADDYYSAILTLFGQGWLQHRYHFTHQGELQPSWHRQR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagcgtttattggcttggacagaaaacaatctggcagccggtgatctcacttcc
cgccttcccgcttggttatgggggcaaaactcacaaaataactgggatattctggaccct
aattcggcctccgatgcggatatcttgattgcctacaacttgctggaggctggcaggtta
tggggtaaccgccgttacctgattatgggtaccttattactgcaacgtattgcgcaagaa
gaagtcatggatattcccggccttggccagatgctattaccgggaaaaattggttttaac
gatgaggatacctggcgtctcaacccaagttatttaccgccacaactactggcacgattt
tcctccatagacgggccttgggaagcgatggtagaagtgaatcagcgtatgtggctggaa
accgcaccaaacggtttttcgctggactgggtggtctggcagaaaggtaaaggctggcag
cccgataccataaaaccggatgtcggcagtaacgatgccattctggtttatctgtgggcg
gggatgctggcaatggacagcccacaaaaagctgaattgattgcgcgttttcagccaatg
gcggtaatcactcagcagcaaggcctgccaccgtttacgaccaacagcgacaatggtaaa
actaacggggatggggcagtgggtttttctgcggcattattgccctttttagccagcagc
ccagaaccgtttaatcagcaaacactgaatctccaacagcgacgggtacaaaattcaccg
cctggcgctgatgattattacagtgctattctgaccctgtttggtcaggggtggttacag
catcgttatcattttacccatcagggagagctacagccctcatggcaccgtcaacgttaa

DBGET integrated database retrieval system