KEGG   Yersinia pestis Nepal516 (biovar Antiqua): YPN_3939Help
Entry
YPN_3939          CDS       T00370                                 

Definition
(GenBank) 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
ypn  Yersinia pestis Nepal516 (biovar Antiqua)
Pathway
ypn00500  Starch and sucrose metabolism
ypn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YPN_3939
Enzymes [BR:ypn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     YPN_3939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: ABG20266
JGI: YPN3939
UniProt: A0A0H2YMW8
Position
complement(4479751..4481847)
Genome map
AA seq 698 aa AA seqDB search
MDRKSLDQAATLAGIAASYINAHGKPQATLAETKEQLLAAMGRSLGAHDTQTANTPLPVV
KVFTFGSPMQLPMAGSGDYHWQLQTENGELHQGRISAKKTLTLPASLPLGYHRLILEQDL
QQWQCSIIVAPKRCYEPDALLQGKKLWGACVQLYTLRSEHNWGIGDFGDLKQMLEQVGER
GGSFIGLNPIHALYPANPHSASPYSPSSRRWLNVIYIDINRVEEFQQSEAAQRWWHQAET
QQALAKSRESEWVDYPLVMQLKLTALRLSFPLFTARKAKDAQVQAFRHFVEQGGSSLHQQ
AVFDALHAHLSEHDPMMWGWPVWPEKYRDGHSSAVADFCREHADEVTFYLWLQWLAASQF
DDCFQSSQQRKMPIGLYRDLAVGVAEGGAETWCDRELYCLKASVGAPPDILGPLGQNWGL
PPMDPHVMVARAYQPFIDLLRANMTSCGALRIDHVMALLRLWWIPYGHTADQGAYVKYPV
DDLLAVLALESQRHHCMVIGEDLGTVPVEIVGKLRDSGVYSYKVLYFEHDSENIFRAPQS
YPVQAMATITTHDLPTLRGYWQADDLTLGNKLGLYPDQQILKQLYLDRERAKQGLLEGLH
RYDCVPKKVGHKAALLSMSPVLNRGLQRYVADSASALLGLQPEDWLDMAAPVNIPGTTDE
YPNWRRKLSASLEEIFADSQINRLLKDLDKRRKNVSVG
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atggatcgtaaatcgctcgatcaagcagcaacactggcagggatagctgccagttacatt
aatgcgcatggtaaaccgcaggcgacgttagcggaaaccaaagagcagttgttggcggcc
atggggcgttctcttggtgctcatgacactcagacagcgaatacccctttgccggtcgtt
aaagtgtttacgtttggtagcccgatgcaattgccaatggccggttctggcgattatcac
tggcagttacagactgagaacggtgagctgcatcaggggcgtatcagtgcgaaaaaaacg
ctgacattgccggcctctttgccgctgggttatcaccgtttgatattggaacaagattta
cagcagtggcagtgttcaatcatcgtggcaccgaaacgctgctatgagcctgatgctttg
ctgcagggaaaaaaactgtggggggcttgcgtacaactgtataccctgcgttccgagcat
aattggggtatcggtgactttggtgatttaaagcagatgttagagcaggtcggtgagcgt
ggtgggtcctttatcggtttaaaccctatccatgcgttatatccggccaacccgcatagt
gctagcccttacagcccgtcatcccggcgctggttgaatgtgatttatatcgacatcaat
agggtcgaggagtttcagcaaagtgaagccgcgcagcgttggtggcatcaagctgagacg
caacaggcgttggcaaaaagtcgggagagcgagtgggttgattacccgttagttatgcag
cttaaattgacggctttgcgcttatccttcccactgtttactgcccgtaaagccaaagat
gcacaggtgcaggcatttcggcactttgttgaacaaggcgggagcagtttacatcagcag
gccgtatttgatgccctacatgcgcatttaagtgagcatgatccgatgatgtggggctgg
ccagtgtggccagagaagtaccgtgatggtcatagtagtgcggtggctgatttttgtcgc
gaacacgctgacgaggtgacgttctatctgtggttacagtggttggcagccagtcaattt
gatgactgcttccaatccagccaacagcggaaaatgccgattggtctgtatcgtgatttg
gcggttggggttgctgaaggtggcgctgaaacctggtgtgaccgcgagttatattgcctg
aaagcatcagtaggtgccccgccagatatcttggggccattaggccagaactgggggcta
ccgccgatggaccctcatgtaatggtcgcgcgcgcgtatcagccttttattgatttactg
cgtgccaatatgaccagttgtggcgcattgcgcatcgaccatgtcatggcattattgcgt
ctgtggtggatcccctacgggcataccgccgatcagggggcttatgtaaaatacccagtg
gatgatttgctggcggtattagcgctggagagtcagcgccaccattgcatggtgattggt
gaagatttaggcacggtaccggtagagattgtgggcaagttacgtgatagcggggtgtat
tcctacaaggtgctctattttgagcatgacagtgagaatatcttccgtgcgccacagtct
tacccggtgcaggcgatggcgaccattacgacccatgatttgccgacactgcgcggttac
tggcaagctgatgatctgactttggggaataagctggggttatatccggatcaacagatt
ttgaagcagctctatcttgacagagagcgagccaaacaagggttattagaagggttacat
cgttacgattgtgtgccgaaaaaagtgggccacaaagcggcactgttatcgatgagccca
gtactgaaccgtggtttgcagcgctatgttgcggatagcgccagtgcattgctggggtta
caaccagaagattggttggatatggcagcaccagtgaatatccccggtaccactgacgag
taccctaactggcggcgtaaattgtcagcgtctctggaagagatatttgccgatagccag
attaatcgtttattgaaagatttggataagcggcgcaaaaacgtttcggttgggtaa

DBGET integrated database retrieval system