KEGG   Yersinia pestis Pestoides F: YPDSF_0625Help
Entry
YPDSF_0625        CDS       T00505                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ypp  Yersinia pestis Pestoides F
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
704244..704960
Genome map
AA seq 238 aa AA seqDB search
MKKSLLLLPMLMAALSGVANADDSAIQQTLKKLDIQQADIQPSPIPGISTVMTESGVLYI
SADGKHLLQGPLYDVSGDQPINVTNQALLKKLEALSSEMIVYKAPEEKHVITVFTDITCG
YCRKLHEQMKDYNALGITVRYLAFPRQGLSSQAEKDMRSIWCMADRNKAFDDAMKNNDIS
PATCKTDISKHYQLGVQFGIQGTPAIVLQNGTIVPGYQGPKEMLQMLNAHQASLKAGG
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagtttattgctgctgccaatgttaatggctgcattatcgggggttgctaat
gcagatgattctgctattcagcaaaccttaaaaaaattagatatccaacaagctgatatc
cagccgtcacctatcccaggcattagtacggtgatgaccgaaagcggcgtgctctatatc
tcagcagatggtaaacatctgctgcaagggccgctgtatgacgtgagtggcgatcagccc
atcaatgtgaccaatcaggcgttgctgaaaaaactggaagcattgagcagtgaaatgatt
gtgtataaagcacccgaggaaaaacacgtcattacggtgttcacagacattacctgcggc
tactgccgtaaattgcacgaacaaatgaaagattataatgcgcttggcatcactgttcgc
tatctggccttcccgcgtcaggggttaagctctcaggcggaaaaagacatgcgttctatc
tggtgtatggctgatcgtaataaagcctttgatgatgccatgaaaaataatgatatctcc
ccagcaacctgcaaaaccgatatcagcaagcattatcagctaggtgtgcaatttggtatc
cagggtacgccagctattgtgctgcaaaatggcactattgtcccaggctatcagggaccg
aaagaaatgctacagatgcttaatgcgcatcaggcttcactaaaagcgggtggttga

DBGET integrated database retrieval system