KEGG   Yersinia pestis Pestoides F: YPDSF_0817Help
Entry
YPDSF_0817        CDS       T00505                                 

Definition
D-lactate dehydrogenase
Orthology
K03778  
D-lactate dehydrogenase [EC:1.1.1.28]
Organism
ypp  Yersinia pestis Pestoides F
Pathway
Pyruvate metabolism
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ypp00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(922543..923535)
Genome map
AA seq 330 aa AA seqDB search
MKLAVYSTKQYDRKYLELVNKDFGFELEFFDFLLTPKTAKMAEGCQAVCLFVNDDGCREI
LTELATIGVKILALRCAGFNNVDLEAAKELGIQVVRVPAYSPEAVAEHTVGMMLSLNRRI
HRAYQRTRDANFSLEGLIGFNMHNRTAGIIGTGKIGVATMRILKGFGMRLLAFDPYPSEQ
ALELGAEYVDLKTLYAESDVISLHCPMTPENHHLLNKQSFDQMKDGVMIINTSRGGLIDS
TAAIDALKQQKIGSLGMDVYENERDLFFEDKSNDVIQDDVFRRLSSCHNVLFTGHQAFLT
EEALTSISVTTLQNIAQLDKGEPCPNIITL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagccgtttacagtaccaagcagtatgaccgtaaataccttgagctggtcaac
aaagattttggctttgaattggagtttttcgattttctgcttacccccaaaaccgccaaa
atggctgagggctgtcaggcggtatgtctcttcgtcaatgatgatggctgccgcgaaata
ttaactgaactggcgactatcggcgttaaaattctggcattgcgttgtgctggctttaat
aacgtggatctggaagcggccaaagagttgggtatacaagtggtccgagtgcccgcatat
tcacctgaagctgtcgcggaacataccgttggcatgatgctgagccttaaccgacgtatt
caccgtgcttatcagcgaacccgtgatgccaatttctcgctggaaggtttgattggtttc
aatatgcataaccgtactgcggggattatcggcacaggtaaaattggtgttgccaccatg
cgtatccttaaaggttttggtatgcgcctgctggcgtttgacccttatccaagtgagcaa
gctctagagctaggtgcagaatatgttgatctgaagaccttgtacgccgagtctgatgtt
atctcactgcattgcccgatgacgccagaaaaccatcatttgctcaataagcagtcattt
gatcaaatgaaagatggcgtgatgatcattaataccagccgtggcggtttaattgattca
acggcggcgatcgatgcgttaaaacaacagaaaataggctccctcggcatggacgtttat
gaaaatgaacgtgatttattctttgaagataaatccaatgacgtgattcaggatgatgtt
ttccgccgtttgtcctcttgccataatgtgttatttactgggcatcaggcgttcctaacc
gaggaagcactcaccagtatctctgtcaccaccttgcagaatattgctcagttggataaa
ggcgaaccctgcccaaatatcatcaccctctga

DBGET integrated database retrieval system